y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma10g05800.1
FamilyAA2
Protein PropertiesLength: 328 Molecular Weight: 36344.5 Isoelectric Point: 6.6648
ChromosomeChromosome/Scaffold: 10 Start: 4539333 End: 4543290
DescriptionPeroxidase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA2443060
  IIKEQVTQLYNKHGNTAVSWVRNLFHDCVVKSCDASLLLATVSDVVSEQASDRSFGMRNFKYVNTIKAAVEKECPLTVSCADIVALSARDGIALLGGPSI
  EMKTGRKDSKESYATEVEALIPNHNDSMSSVLSRFQAIGIDVEATVALLGAHSVGRVHCKNLVHRLYPTVDSTLNPAHAEYLKRRCPTPNPDPKAVLYSR
  NDLKTPMIIDNNYYKNILQHKGLLIVDEELATDPITAPYVQKMANDNDYFNQQFSRAILLLSE
Full Sequence
Protein Sequence     Length: 328     Download
MATITKPPSN ICFLLLLLLA HFHLGESQVE LNYYSKSCPK AEEIIKEQVT QLYNKHGNTA    60
VSWVRNLFHD CVVKSCDASL LLATVSDVVS EQASDRSFGM RNFKYVNTIK AAVEKECPLT    120
VSCADIVALS ARDGIALLGG PSIEMKTGRK DSKESYATEV EALIPNHNDS MSSVLSRFQA    180
IGIDVEATVA LLGAHSVGRV HCKNLVHRLY PTVDSTLNPA HAEYLKRRCP TPNPDPKAVL    240
YSRNDLKTPM IIDNNYYKNI LQHKGLLIVD EELATDPITA PYVQKMANDN DYFNQQFSRA    300
ILLLSETNPL TGDEGEIRKD CRYLNAN*                                       360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00141peroxidase2.0e-625828932+
cd00314plant_peroxidase_like2.0e-2143300288+
pfam00141peroxidase4.0e-4845197154+
PLN03030PLN030302.0e-5233325305+
cd00693secretory_peroxidase9.0e-13728322300+
Gene Ontology
GO TermDescription
GO:0004601peroxidase activity
GO:0006979response to oxidative stress
GO:0020037heme binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAM65003.102232523327putative peroxidase ATP2a [Arabidopsis thaliana]
GenBankACN97181.102132725331peroxidase [Populus trichocarpa]
RefSeqNP_181250.102232523327peroxidase 21 (PER21) (P21) (PRXR5) [Arabidopsis thaliana]
RefSeqXP_002275288.102532527327PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002326343.102132725331predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1bgp_A0293259305A Chain A, Crystal Structure Of Barley Grain Peroxidase 1
PDB1qo4_A0283262305A Chain A, Crystal Structure Of Barley Grain Peroxidase 1
PDB1pa2_A0283262305A Chain A, Arabidopsis Thaliana Peroxidase A2
PDB1sch_B0283251294A Chain A, Peanut Peroxidase
PDB1sch_A0283251294A Chain A, Peanut Peroxidase
Metabolic Pathways
Pathway NameReactionECProtein Name
betanidin degradationRXN-8635EC-1.11.1.7peroxidase
Signal Peptide
Cleavage Site
27
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CF92216527312730
FC45802126622650
GR832545244362790
ES902440292223120
FF400909251643120
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_001_00478.1Aquca_005_00071.2Aquca_005_00071.1Aquca_016_00057.1Aquca_005_00071.3
Arabidopsis lyrata898035492673345443
Arabidopsis thalianaAT3G17070.1AT2G37130.2AT2G37130.1AT4G21960.1
Brassica rapaBra022195Bra017206Bra023099Bra013576
Carica papayaevm.model.supercontig_152.14evm.model.supercontig_525.1
Capsella rubellaCarubv10014103mCarubv10023623mCarubv10005223m
Citrus clementinaCiclev10026124mCiclev10026035mCiclev10012170mCiclev10015870mCiclev10016494m
Citrus sinensisorange1.1g045164morange1.1g020143morange1.1g020084morange1.1g021519morange1.1g019854m
orange1.1g019129morange1.1g021841morange1.1g026488morange1.1g020712morange1.1g021207m
orange1.1g028028morange1.1g036121m
Cucumis sativusCucsa.307020.2Cucsa.307020.1Cucsa.085830.1Cucsa.124250.1Cucsa.307020.3
Eucalyptus grandisEucgr.E03999.1Eucgr.E04056.1Eucgr.D01322.1Eucgr.A01166.1
Fragaria vescamrna05105.1-v1.0-hybridmrna25836.1-v1.0-hybridmrna19619.1-v1.0-hybridmrna09649.1-v1.0-hybrid
Glycine maxGlyma07g39290.1Glyma17g01440.2Glyma13g20170.1Glyma17g01720.1Glyma07g39020.1
Glyma04g10761.1
Gossypium raimondiiGorai.011G200600.1Gorai.006G168000.3Gorai.006G168000.1Gorai.009G419100.1Gorai.006G168000.2
Gorai.009G178400.1
Linum usitatissimumLus10015074Lus10006778Lus10020045
Malus domesticaMDP0000292744MDP0000124622MDP0000303101MDP0000545323MDP0000192235
Manihot esculentacassava4.1_011604mcassava4.1_012064mcassava4.1_031903m
Medicago truncatulaMedtr6g045330.1Medtr4g132490.1Medtr4g132110.2Medtr1g066380.1Medtr4g132110.1
Medtr1g066380.2Medtr4g132110.3
Mimulus guttatusmgv1a009704mmgv1a009981mmgv1a010406mmgv1a007622mmgv1a010067m
mgv1a019681mmgv1a025816mmgv1a026804m
Oryza sativaLOC_Os07g49360.1LOC_Os05g14260.1
Panicum virgatumPavirv00050429mPavirv00010935m
Physcomitrella patensPp1s8_186V6.1Pp1s44_71V6.1Pp1s10_225V6.1Pp1s62_126V6.1Pp1s16_148V6.1
Pp1s104_177V6.3Pp1s104_177V6.2Pp1s104_177V6.1Pp1s433_15V6.2Pp1s433_15V6.1
Phaseolus vulgarisPhvul.007G107400.1Phvul.003G078600.1
Picea abiesMA_83406g0010MA_530154g0010MA_10432809g0020MA_10427936g0010MA_6481365g0010
MA_10432809g0010
Populus trichocarpaPotri.004G015300.2Potri.004G015300.1Potri.006G129900.1Potri.004G006400.1
Prunus persicappa008634mppa022386mppa008503m
Ricinus communis29842.m00359530078.m002355
Setaria italicaSi022597m
Selaginella moellendorffii10502977725116945140930107369
1370671793877725976459403456
11598223276377662
Sorghum bicolorSb09g007950.1Sb09g018150.1
Thellungiella halophilaThhalv10021081mThhalv10016921mThhalv10025680m
Vitis viniferaGSVIVT01034984001GSVIVT01025650001GSVIVT01012727001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)