y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma10g11720.3
FamilyGH89
Protein PropertiesLength: 808 Molecular Weight: 92414.7 Isoelectric Point: 7.268
ChromosomeChromosome/Scaffold: 10 Start: 12054324 End: 12096017
Descriptionalpha-N-acetylglucosaminidase family / NAGLU family
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH89927980
  PEIIIRGTTAVEIASGLHWYLKYWCGAHVSWDKTGGIQTTSIPEPGSLPSLKDEGLKIKRPVPWNYYQNVVTSSYSYVWWNWERWEKELDWMALQGVNLP
  LAFTGQEAIWQKVFKDFNISSKDLNNFFGGPAFLAWARMGNLHGWGGPLSQNWLDQQLVLQKQIISRMLELGMTPVLPSFSGNVPAALTKIFPSAKITRL
  GDWNTVDGDPRWCCTYLLDPSDPLFVEIGEAFIRKQIKEYGDVTDIYNCDTFNENSPPTNDPEYISNLGAAVYKGISKGDKDAVWLMQGWLFYSDSSFWK
  PPQMKALLHSVPFGKMIVLDLFADVKPIWKNSFQFYGTPYIWCMLHNFGGNIEMYGTLDSISSGPVDARVSANSTMVGVGMCMEGIEQNPIVYELMSEMA
  FRDKKVKVSEWIKSYCHRRYGKVIHQVESAWEILYHTIYNCTDGIADHNHDFIVMFPDWNPSTNSVTGTSNNQKIYLLPPGNRRYLFQETLSDMPQAHLW
  YPSDDVIKALQLFLAGGKNLAGSLTYRYDLVDLTRQVLSKLANQVYHKAVTSYQKKNIEALQFHSNKFLQLIKDIDVLLASDDNFLLGTWLESAKKLAVN
  PSEIKQYEWNARTQVTMWFDTNETTQSKLHDYANKFWSGLLESYYLPRASTYFSHLTESLRQNDKFKLIEWRKQWISQSNKWQEGNELYPVKAKGDALTI
  SQALYEK
Full Sequence
Protein Sequence     Length: 808     Download
MLKLGFVFLI LILTPLLPAA LSKYEAIEPL LQRLDSKRAP PSVQEAAAIG LLKRLLPIHF    60
SSFQFKIVSK DVCGGDSCFL INNHNKSSQN EPEIIIRGTT AVEIASGLHW YLKYWCGAHV    120
SWDKTGGIQT TSIPEPGSLP SLKDEGLKIK RPVPWNYYQN VVTSSYSYVW WNWERWEKEL    180
DWMALQGVNL PLAFTGQEAI WQKVFKDFNI SSKDLNNFFG GPAFLAWARM GNLHGWGGPL    240
SQNWLDQQLV LQKQIISRML ELGMTPVLPS FSGNVPAALT KIFPSAKITR LGDWNTVDGD    300
PRWCCTYLLD PSDPLFVEIG EAFIRKQIKE YGDVTDIYNC DTFNENSPPT NDPEYISNLG    360
AAVYKGISKG DKDAVWLMQG WLFYSDSSFW KPPQMKALLH SVPFGKMIVL DLFADVKPIW    420
KNSFQFYGTP YIWCMLHNFG GNIEMYGTLD SISSGPVDAR VSANSTMVGV GMCMEGIEQN    480
PIVYELMSEM AFRDKKVKVS EWIKSYCHRR YGKVIHQVES AWEILYHTIY NCTDGIADHN    540
HDFIVMFPDW NPSTNSVTGT SNNQKIYLLP PGNRRYLFQE TLSDMPQAHL WYPSDDVIKA    600
LQLFLAGGKN LAGSLTYRYD LVDLTRQVLS KLANQVYHKA VTSYQKKNIE ALQFHSNKFL    660
QLIKDIDVLL ASDDNFLLGT WLESAKKLAV NPSEIKQYEW NARTQVTMWF DTNETTQSKL    720
HDYANKFWSG LLESYYLPRA STYFSHLTES LRQNDKFKLI EWRKQWISQS NKWQEGNELY    780
PVKAKGDALT ISQALYEKYF QNKLINH*                                       840
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam12971NAGLU_N2.0e-214413693+
pfam12972NAGLU_C3.0e-105501799299+
pfam05089NAGLU0157493337+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI24942.10680069867unnamed protein product [Vitis vinifera]
GenBankEEC75285.103980151812hypothetical protein OsI_11626 [Oryza sativa Indica Group]
RefSeqNP_196873.102480025805alpha-N-acetylglucosaminidase family / NAGLU family [Arabidopsis thaliana]
RefSeqXP_002273084.1068004802PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002314048.102080022805predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vcc_A051789177866A Chain A, Structural Insights Into The Processivity Of Endopolygalacturonase I From Aspergillus Niger
PDB2vcb_A051789177866A Chain A, Structural Insights Into The Processivity Of Endopolygalacturonase I From Aspergillus Niger
PDB2vca_A051789177866A Chain A, Structural Insights Into The Processivity Of Endopolygalacturonase I From Aspergillus Niger
PDB2vc9_A051789177866A Chain A, Family 89 Glycoside Hydrolase From Clostridium Perfringens In Complex With 2-Acetamido-1,2-Dideoxynojirmycin
PDB4a4a_A051789200889A Chain A, Cpgh89 (E483q, E601q), From Clostridium Perfringens, In Complex With Its Substrate Glcnac-Alpha-1,4-Galactose
Signal Peptide
Cleavage Site
22
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7834553223026220
HO7834551486317780
GT6276572712044740
GT6223562732775490
HO783455336226540.1
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_057_00157.1Aquca_039_00072.1Aquca_057_00157.2Aquca_057_00157.3Aquca_057_00157.4
Aquca_002_00330.4.155.497Aquca_002_00330.4.155.497Aquca_002_00330.2.100.442Aquca_002_00330.2.100.442Aquca_002_00330.1.155.497
Aquca_002_00330.1.155.497Aquca_002_00330.3.100.434Aquca_002_00330.3.100.434Aquca_002_00330.1.514.887Aquca_002_00330.1.514.887
Aquca_002_00330.3.451.826Aquca_002_00330.3.451.826Aquca_002_00330.2.459.834Aquca_002_00330.2.459.834Aquca_002_00330.4.514.785
Aquca_002_00330.4.514.785
Arabidopsis lyrata488189
Arabidopsis thalianaAT5G13690.1
Brachypodium distachyonBradi1g62007.1Bradi5g24207.1
Brassica rapaBra023429
Carica papayaevm.model.supercontig_125.32evm.model.supercontig_35.39evm.model.supercontig_35.44
Capsella rubellaCarubv10000251m
Citrus clementinaCiclev10030724mCiclev10018883mCiclev10019020mCiclev10019066mCiclev10019065m
Citrus sinensisorange1.1g003545morange1.1g006843morange1.1g006829morange1.1g008173morange1.1g009062m
orange1.1g009057morange1.1g009049morange1.1g012032morange1.1g012026morange1.1g009153m.237.531
orange1.1g009153m.237.531
Cucumis sativusCucsa.128090.1Cucsa.197210.1
Eucalyptus grandisEucgr.B00338.1Eucgr.G03358.1Eucgr.G03358.2Eucgr.B00338.2
Fragaria vescamrna09491.1-v1.0-hybrid.106.845mrna29475.1-v1.0-hybrid
Glycine maxGlyma06g19791.1.94.437Glyma06g19791.1.94.437Glyma06g19791.1.438.763Glyma06g19791.1.438.763
Gossypium raimondiiGorai.004G170700.1Gorai.004G170700.3Gorai.004G170700.4Gorai.004G170700.2.346.780Gorai.004G170700.2.346.780
Gorai.001G078400.1.96.430Gorai.001G078400.1.96.430Gorai.004G170700.2.108.346Gorai.004G170700.2.108.346Gorai.001G078400.1.466.832
Gorai.001G078400.1.466.832
Linum usitatissimumLus10039598Lus10029494Lus10043468Lus10034116.106.408Lus10034116.106.408
Lus10034116.462.875Lus10034116.462.875
Malus domesticaMDP0000220242MDP0000138607MDP0000208532MDP0000203950MDP0000134637
Manihot esculentacassava4.1_001859mcassava4.1_003710mcassava4.1_022588mcassava4.1_012214m
Medicago truncatulaMedtr3g032980.2.357.804Medtr3g032980.2.357.804Medtr3g032980.1.357.829Medtr3g032980.1.357.829Medtr3g032980.3.95.333
Medtr3g032980.3.95.333Medtr3g032980.2.95.333Medtr3g032980.2.95.333Medtr3g032980.1.95.333Medtr3g032980.1.95.333
Medtr3g032980.3.357.529Medtr3g032980.3.357.529
Mimulus guttatusmgv1a001508mmgv1a018437m
Oryza sativaLOC_Os04g55730.1.99.440LOC_Os04g55730.1.99.440LOC_Os04g55730.1.441.772LOC_Os04g55730.1.441.772
Panicum virgatumPavirv00063217mPavirv00008468mPavirv00041670mPavirv00026596m.238.567Pavirv00026596m.238.567
Physcomitrella patensPp1s329_23V6.1
Phaseolus vulgarisPhvul.005G023300.1Phvul.005G023300.2Phvul.009G182100.1.92.435Phvul.009G182100.1.92.435Phvul.009G182100.2.253.577
Phvul.009G182100.2.253.577Phvul.009G182100.1.436.760Phvul.009G182100.1.436.760
Picea abiesMA_10437144g0010
Populus trichocarpaPotri.009G058100.1Potri.012G075900.1.100.435Potri.012G075900.1.100.435Potri.012G075900.1.436.751Potri.012G075900.1.436.751
Prunus persicappa001555mppa001642m
Ricinus communis30147.m01401129864.m001461
Setaria italicaSi034295mSi009392m.103.444Si009392m.103.444Si009392m.445.774Si009392m.445.774
Selaginella moellendorffii102402
Sorghum bicolorSb01g034960.1Sb06g030930.1
Thellungiella halophilaThhalv10012727m
Vitis viniferaGSVIVT01032165001GSVIVT01007826001.97.439GSVIVT01007826001.97.439GSVIVT01007826001.468.836GSVIVT01007826001.468.836
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)