y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma10g15730.1
FamilyGT1
Protein PropertiesLength: 465 Molecular Weight: 52557.8 Isoelectric Point: 6.825
ChromosomeChromosome/Scaffold: 10 Start: 18278641 End: 18280403
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT12504372.2e-31
  PKTRHICIEWLDKQEANSVMYVSFGTTTSFTVAQFEQIAIGLEQSKQKFIWVLRDADKGNIFDGSEAERYELPNGFEERVEGIGLLIRDWAPQLEILSHT
  STGGFMSHCGWNSCLESITMGVPIAAWPMHSDQPRNSVLITEVLKVGFVVKDWAQRNALVSASVVENAVRRLMETKEGDEMRDRAVRL
Full Sequence
Protein Sequence     Length: 465     Download
MASNEKTLPH QTQVVLIPFP AQGHLNQLLH LARHIFSHNI PVHYVGTATH IRQATLRDHN    60
SNISNIIIHF HAFEVPPFVS PPPNPNNEET DFPSHLLPSF KASSHLREPV RNLLQSLSSQ    120
AKRVIVIHDS LMASVAQDAT NMPNVENYTF HSTCAFTTFL YYWEVMGRPP VEGFFQATEI    180
PSMGGCFPPQ FIHFITEEYE FHQFNDGNIY NTSRAIEGPY IEFLERIGGS KKRLWALGPF    240
NPLTIEKKDP KTRHICIEWL DKQEANSVMY VSFGTTTSFT VAQFEQIAIG LEQSKQKFIW    300
VLRDADKGNI FDGSEAERYE LPNGFEERVE GIGLLIRDWA PQLEILSHTS TGGFMSHCGW    360
NSCLESITMG VPIAAWPMHS DQPRNSVLIT EVLKVGFVVK DWAQRNALVS ASVVENAVRR    420
LMETKEGDEM RDRAVRLKNC IHRSKYGGGV SRMEMGSFIA HITK*                    480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02448PLN024488.0e-49256464211+
PLN02534PLN025341.0e-5011464495+
PLN02863PLN028632.0e-51194462278+
PLN03007PLN030078.0e-55194463282+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAM09513.2014641461AF489873_1 putative glucosyltransferase [Glycine max]
GenBankAAM09514.2014641464AF489874_1 zeatin O-glucosyltransferase [Glycine max]
GenBankAAM09516.1014641462AF489876_1 putative glucosyltransferase [Phaseolus lunatus]
GenBankAAM09517.1014641462AF489877_1 putative glucosyltransferase [Phaseolus lunatus]
Swiss-ProtQ9ZSK5014641459ZOG_PHALU RecName: Full=Zeatin O-glucosyltransferase; AltName: Full=Trans-zeatin O-beta-D-glucosyltransferase
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vg8_A054513456B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB2vch_A054513456B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB2vce_A054513456A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2acw_B8e-381246310462A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
PDB2acw_A8e-381246310462A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
Metabolic Pathways
Pathway NameReactionECProtein Name
cytokinins-O-glucoside biosynthesisRXN-4723EC-2.4.1.203trans-zeatin O-β-D-glucosyltransferase
cytokinins-O-glucoside biosynthesisRXN-4726EC-2.4.1UDP-glucose:dihydrozeatin O-β-D-glucosyltransferase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EG63125247514650
HO7835653151554650
FE7065302681984650
FE7075262641854480
FE7065332252414650
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00739.1Aquca_009_00322.1Aquca_009_00320.1Aquca_009_00319.1Aquca_009_00323.1
Brachypodium distachyonBradi1g18820.1Bradi5g18030.1Bradi2g06130.1Bradi5g18020.1Bradi5g18040.1
Bradi5g18010.1
Carica papayaevm.model.supercontig_182.5
Citrus clementinaCiclev10004886m
Citrus sinensisorange1.1g039436m
Cucumis sativusCucsa.191200.1Cucsa.269020.1Cucsa.269030.1
Eucalyptus grandisEucgr.A02328.1Eucgr.A02326.1Eucgr.A02321.1Eucgr.B02735.1Eucgr.A02320.1
Eucgr.A02318.1Eucgr.A02314.1Eucgr.A02323.1Eucgr.A02308.1Eucgr.A02330.1
Eucgr.A02329.1
Fragaria vescamrna21990.1-v1.0-hybrid
Glycine maxGlyma02g11653.1.385.490Glyma02g11653.1.385.490Glyma02g32770.1Glyma10g15790.1Glyma19g31820.2
Glyma03g29051.1Glyma02g32020.1
Gossypium raimondiiGorai.002G227900.1
Malus domesticaMDP0000850255MDP0000793268
Manihot esculentacassava4.1_024063mcassava4.1_029572m
Mimulus guttatusmgv1a027163mmgv1a026906mmgv1a022179mmgv1a017976mmgv1a023637m
mgv1a005799mmgv1a024073mmgv1a019962mmgv1a004882mmgv1a005868m
Oryza sativaLOC_Os04g47720.1LOC_Os04g47770.1LOC_Os04g46980.1LOC_Os04g46990.1LOC_Os07g46610.1
LOC_Os04g46970.1
Panicum virgatumPavirv00029796mPavirv00035426mPavirv00007661mPavirv00044408mPavirv00053815m
Pavirv00024885mPavirv00057452mPavirv00068157mPavirv00034673mPavirv00059670m
Pavirv00012261mPavirv00023426mPavirv00031716mPavirv00023425mPavirv00023663m
Pavirv00006748m
Physcomitrella patensPp1s243_16V6.4Pp1s243_16V6.3Pp1s243_16V6.2Pp1s243_16V6.1Pp1s93_74V6.1
Phaseolus vulgarisPhvul.007G251200.1Phvul.007G251100.1Phvul.007G251000.1Phvul.007G251300.1Phvul.008G103900.1
Phvul.001G129900.1
Picea abiesMA_152538g0010MA_10661g0020MA_125120g0010MA_175870g0010MA_658172g0010
MA_9576120g0010MA_10347747g0010
Populus trichocarpaPotri.006G048200.1Potri.016G057300.1Potri.006G047200.1
Prunus persicappa005515m
Ricinus communis29937.m00020729937.m000209
Setaria italicaSi010032mSi010040mSi029740mSi010038mSi012663m
Si010045mSi012135m
Sorghum bicolorSb06g024946.1Sb06g024960.1Sb06g024950.1Sb10g027940.1Sb02g041935.1
Sb06g024970.1Sb06g012280.1Sb06g024930.1
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)