y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma10g29550.1
FamilyGH2
Protein PropertiesLength: 976 Molecular Weight: 110474 Isoelectric Point: 6.5079
ChromosomeChromosome/Scaffold: 10 Start: 38393119 End: 38399083
Descriptionglycoside hydrolase family 2 protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH2327560
  PSASTQPWMEAIVPGTVLATLVKNKAVPDPFYGLGNEAILDIADSGREYYTFWFFTTFQCKLSGNQHCDLNFRGINYSADVYLNGHEMVLPKGMFRRHSL
  DVTNIIHSDSSNLLAVLVHPPDHPGSIPPQGGQGGDHEIGKDVATQYVQGWDWMAPIRDRNTGIWDEVSISITGPVKIIDPHLVSSFFDNYKRVYLHATT
  ELENRSSLIAECSLSIHVTTELEGNIHLVEQLQTQNLSIPARSRVQYTFPELFFYKPNLWWPNGMGKQSLYNVIITIDVKGHGESDSWNHHFGFRKIESH
  IDVATGGRLFKVNGEPIFIRGGNWILSDGLLRLSKKRYETDIKFHADMNFNMIRCWGGGLAERPEFYRCCDYYGLLVWQEFWITGDVDGRGIPVSNPNGP
  LDHDLFLFCARDTVKLLRNHPSLALWVGGNEQTPPDDLNVALKNDLKLHPYFGHAEEKEKPVGDLSPRLGDPSQYLDGTRIYIQGSLWDGFADGEGDFSD
  GPYEIQNPEDFFTDSFYNHGFNPEVGSVGMPVASTIRAIMPSEGWQIPLFNKLPNGYVEEVPNPIWKYHKYIPYSNPTKKVHDQIQLYGDVKDLDDFCLK
  AQLVNYIQYRALLEGWTSRMWKKYTGVLIWKTQNPWTGLRGQFYDHLLDQTAGFYGCRCAAEPIHVQLNLATYFIEVVNTTSEELSNLAMEVSVWDLEGT
  CPHYKVHENLTALPKKVTPIVDMKY
Full Sequence
Protein Sequence     Length: 976     Download
MMAKTTLDSG WLAARSTEVH FTGTQLTTTH PPSASTQPWM EAIVPGTVLA TLVKNKAVPD    60
PFYGLGNEAI LDIADSGREY YTFWFFTTFQ CKLSGNQHCD LNFRGINYSA DVYLNGHEMV    120
LPKGMFRRHS LDVTNIIHSD SSNLLAVLVH PPDHPGSIPP QGGQGGDHEI GKDVATQYVQ    180
GWDWMAPIRD RNTGIWDEVS ISITGPVKII DPHLVSSFFD NYKRVYLHAT TELENRSSLI    240
AECSLSIHVT TELEGNIHLV EQLQTQNLSI PARSRVQYTF PELFFYKPNL WWPNGMGKQS    300
LYNVIITIDV KGHGESDSWN HHFGFRKIES HIDVATGGRL FKVNGEPIFI RGGNWILSDG    360
LLRLSKKRYE TDIKFHADMN FNMIRCWGGG LAERPEFYRC CDYYGLLVWQ EFWITGDVDG    420
RGIPVSNPNG PLDHDLFLFC ARDTVKLLRN HPSLALWVGG NEQTPPDDLN VALKNDLKLH    480
PYFGHAEEKE KPVGDLSPRL GDPSQYLDGT RIYIQGSLWD GFADGEGDFS DGPYEIQNPE    540
DFFTDSFYNH GFNPEVGSVG MPVASTIRAI MPSEGWQIPL FNKLPNGYVE EVPNPIWKYH    600
KYIPYSNPTK KVHDQIQLYG DVKDLDDFCL KAQLVNYIQY RALLEGWTSR MWKKYTGVLI    660
WKTQNPWTGL RGQFYDHLLD QTAGFYGCRC AAEPIHVQLN LATYFIEVVN TTSEELSNLA    720
MEVSVWDLEG TCPHYKVHEN LTALPKKVTP IVDMKYLKSK NPKPVYFLLL KLYKMSDNTI    780
LSRNFYWLHL PGGDYKLLEP YRKKKIPLKI TSEVFIEGST YILQMHVQNT SKKPDSKSLT    840
MVHSSTARQS SGCFVTDSLE TVDSGTGKEH EVGWFKGIHK CFAGKSHGLK VSEINGQDTG    900
VAFFLHFSVH ASNKDHKEGE DTRILPIHYS DNYFSLVPGE TMTIKISFEV PSGVSPCVTL    960
RGWNYQGQTI HEALY*                                                    1020
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam02836Glyco_hydro_2_C5.0e-5334462139+
PRK09525lacZ8.0e-7288462202+
pfam00703Glyco_hydro_29.0e-11207326120+
PRK10340ebgA1.0e-1196462382+
COG3250LacZ9.0e-3944462443+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN82620.1029644965hypothetical protein [Vitis vinifera]
EMBLCBI36793.1029644943unnamed protein product [Vitis vinifera]
RefSeqXP_002284576.1029644965PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002319539.1029664967predicted protein [Populus trichocarpa]
RefSeqXP_002512381.1029674968beta-mannosidase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vzo_B03278874767A Chain A, Crystal Structure Of Amycolatopsis Orientalis Exo- Chitosanase Csxa
PDB2vzo_A03278874767A Chain A, Crystal Structure Of Amycolatopsis Orientalis Exo- Chitosanase Csxa
PDB2x09_B03278874767A Chain A, Crystal Structure Of Amycolatopsis Orientalis Exo- Chitosanase Csxa
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
ES7939203833707470
ES8327903064968010
GO8716003342986310
GO8476393535158670
ES8188072831674490
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_017_00437.1Aquca_017_00437.4Aquca_054_00086.1Aquca_017_00437.2Aquca_017_00437.5
Aquca_017_00437.3
Arabidopsis lyrata888134
Arabidopsis thalianaAT1G09010.1
Brachypodium distachyonBradi2g26600.1
Brassica rapaBra018587Bra030751
Carica papayaevm.model.supercontig_48.57
Capsella rubellaCarubv10008228m
Citrus clementinaCiclev10000150mCiclev10000160m
Citrus sinensisorange1.1g045314m
Cucumis sativusCucsa.182080.2Cucsa.182080.1
Eucalyptus grandisEucgr.H04490.2Eucgr.H04490.1Eucgr.H04490.3
Fragaria vescamrna22540.1-v1.0-hybrid
Glycine maxGlyma20g37760.1Glyma03g39810.1Glyma19g42370.1
Gossypium raimondiiGorai.013G124100.1Gorai.007G297200.2Gorai.007G297200.1Gorai.007G297200.3Gorai.007G297200.4
Linum usitatissimumLus10029917Lus10004484
Malus domesticaMDP0000300462MDP0000144916MDP0000026514MDP0000210658
Manihot esculentacassava4.1_001014m
Medicago truncatulaMedtr7g113570.1Medtr1g082890.1
Mimulus guttatusmgv1a023381mmgv1a000882mmgv1a024358m
Oryza sativaLOC_Os05g32530.1
Panicum virgatumPavirv00050693mPavirv00063196mPavirv00063197m
Physcomitrella patensPp1s2985_1V6.1Pp1s99_248V6.1Pp1s114_165V6.1
Phaseolus vulgarisPhvul.007G180100.1Phvul.006G092100.1
Picea abiesMA_10427468g0010
Populus trichocarpaPotri.013G021200.4Potri.013G021200.3Potri.013G021200.1Potri.013G021200.2
Prunus persicappa000875mppa000882m
Ricinus communis30128.m008776
Setaria italicaSi021098m
Selaginella moellendorffii164536
Sorghum bicolorSb09g019350.1
Thellungiella halophilaThhalv10006730m
Vitis viniferaGSVIVT01000073001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny