y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma10g31550.2
FamilyGH17
Protein PropertiesLength: 341 Molecular Weight: 36665.9 Isoelectric Point: 8.0249
ChromosomeChromosome/Scaffold: 10 Start: 40028585 End: 40032337
DescriptionGlycosyl hydrolase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1712740
  MVGLGNEYLSRMKDPKQAQAWIKANLQPYLPATKITSIFVGNEVLTFNDTSLTSNLLPAMQSVHAALINLGLDKQITVTTTHSLAVLQTSYPPSAGAFRP
  DLAPCLAPILSFQAKTGSPFLINAYPYFAYKANPKQVPLEYVLFQPNEGMVDPSSNLHYDNMLFAQIDAVYSALDSLGYGKLPVHISETGWPSKGDQDEA
  GANLENAKKYNGNLIKMAMSSSSSAKKGTPCRPNEDLNIYVFALFNENMKPGPASERNYGLFKPDGTPAYPLGF
Full Sequence
Protein Sequence     Length: 341     Download
MVGLGNEYLS RMKDPKQAQA WIKANLQPYL PATKITSIFV GNEVLTFNDT SLTSNLLPAM    60
QSVHAALINL GLDKQITVTT THSLAVLQTS YPPSAGAFRP DLAPCLAPIL SFQAKTGSPF    120
LINAYPYFAY KANPKQVPLE YVLFQPNEGM VDPSSNLHYD NMLFAQIDAV YSALDSLGYG    180
KLPVHISETG WPSKGDQDEA GANLENAKKY NGNLIKMAMS SSSSAKKGTP CRPNEDLNIY    240
VFALFNENMK PGPASERNYG LFKPDGTPAY PLGFSLASVP VVAGNNNTGV ASTPPQPTSP    300
TSSTGYLSIS SASSLERCRL LGRSLSFLVP LVMELLILKF *                        360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG5309COG53098.0e-923265251+
pfam00332Glyco_hydro_172.0e-761274275+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PIR0127382349UP10_LACSN Unknown protein 10 from 2D-PAGE
RefSeqXP_002278950.10133977404PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002300505.10127365332predicted protein [Populus trichocarpa]
RefSeqXP_002317055.10128555334predicted protein [Populus trichocarpa]
RefSeqXP_002518930.10133976402Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2cyg_A01027461312A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3f55_D0127552316A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3f55_C0127552316A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3f55_B0127552316A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3f55_A0127552316A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EX65832026912690
CF11932226792750
EX29947127132730
EE06662525612560
CA937007191172070
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_004_00387.1Aquca_028_00029.3.12.329Aquca_028_00029.2.24.341Aquca_028_00029.1.24.341Aquca_015_00316.1.26.346
Aquca_004_00145.5Aquca_004_00145.4Aquca_004_00145.3Aquca_004_00145.2Aquca_004_00145.1
Aquca_037_00225.1.25.339Aquca_010_00473.4Aquca_010_00473.3Aquca_010_00473.2.30.348Aquca_010_00473.1.30.348
Aquca_027_00361.1.33.346Aquca_020_00100.4Aquca_020_00100.3Aquca_020_00100.2Aquca_020_00100.1
Aquca_032_00084.5.24.343Aquca_032_00084.4.24.343Aquca_032_00084.3.25.344Aquca_032_00084.2.24.343Aquca_032_00084.1.25.344
Aquca_020_00396.2.46.363Aquca_020_00396.1.46.363Aquca_004_00387.2Aquca_013_00005.2Aquca_013_00005.1
Aquca_013_00005.3Aquca_004_00145.6Aquca_006_00019.1Aquca_003_00044.1.27.339Aquca_028_00029.4
Arabidopsis lyrata495603.28.346890866881306915975480193.25.344
493031491210351455.16.330868951480794.25.342
494762481526329002.26.344318360865962
485970.29.341321648.30.338
Arabidopsis thalianaAT4G26830.1.25.343AT5G55180.2.27.345AT5G55180.1.27.345AT5G42100.2AT5G42100.1
AT1G32860.1AT1G30080.1AT5G24318.2.30.344AT5G24318.1.30.344AT2G05790.1.25.344
AT2G27500.2AT2G27500.1AT4G18340.1AT2G16230.1.25.342AT2G26600.1
AT4G34480.1.26.343AT3G15800.1AT5G42720.1AT3G46570.1AT3G55430.1.29.341
AT2G26600.2AT2G27500.3AT2G39640.1.30.338
Brachypodium distachyonBradi3g44910.1Bradi2g23940.1Bradi5g09327.1Bradi1g38755.1Bradi3g57610.1.30.353
Bradi3g20770.1Bradi1g68450.1Bradi2g55690.1Bradi1g50080.1Bradi3g07385.1
Bradi1g53590.1Bradi4g09230.2.39.357Bradi4g09230.1.39.357Bradi1g25530.1.28.359Bradi1g25517.1.30.376
Bradi1g36460.2Bradi1g36460.1Bradi1g12810.1.31.348Bradi1g69020.1Bradi1g10347.1
Bradi1g55203.1Bradi3g33257.1Bradi3g33277.1Bradi5g26467.1.20.354
Brassica rapaBra035561.27.346Bra012015Bra028988.142.461Bra032357Bra028526
Bra010800Bra023293Bra013297Bra015166.25.344Bra012604
Bra002927.27.346Bra000508Bra021137Bra036510.18.332Bra033641
Bra019084.153.381Bra019084.153.381Bra000536Bra007162.28.340Bra039852.26.343
Bra007161.29.341Bra014747.29.341Bra003212.28.340Bra011537.26.342Bra027207
Bra005028.30.338Bra017659.26.265Bra017659.26.265
Carica papayaevm.model.supercontig_12.252.24.343evm.model.supercontig_3.108.23.337evm.model.supercontig_37.95evm.model.supercontig_32.24evm.model.supercontig_10.263
evm.model.supercontig_132.21.24.343evm.model.supercontig_81.143.27.339evm.model.supercontig_62.143.29.345evm.model.supercontig_36.69.30.347evm.model.supercontig_46.17
evm.model.supercontig_78.32.27.345evm.model.supercontig_1.407.27.338evm.model.supercontig_26.161.29.329
Capsella rubellaCarubv10026374m.24.342Carubv10004894mCarubv10000922m.10.324Carubv10009196mCarubv10011427m
Carubv10004986mCarubv10023375mCarubv10013604m.26.345Carubv10015799m.21.338Carubv10013884m
Carubv10026453mCarubv10018875mCarubv10017225m.33.345Carubv10023397mCarubv10025141m.30.338
Citrus clementinaCiclev10028637mCiclev10020391mCiclev10020386mCiclev10025771mCiclev10015646m
Ciclev10033472m.29.342Ciclev10015086m.33.352Ciclev10008176m.27.345Ciclev10028656mCiclev10028372m.31.346
Ciclev10020075m.31.345Ciclev10028241m.32.344Ciclev10008080m.26.344Ciclev10008555m
Citrus sinensisorange1.1g011390m.37.373orange1.1g043682morange1.1g015411morange1.1g015273morange1.1g015263m
orange1.1g041112morange1.1g017202morange1.1g016045morange1.1g009301m.93.412orange1.1g012262m.31.346
orange1.1g043079m.31.345orange1.1g012052m.26.344orange1.1g011895m.26.344orange1.1g011551m.26.344orange1.1g037583m.32.344
orange1.1g013292m.26.344orange1.1g010782m.26.344orange1.1g017408morange1.1g016232morange1.1g038452m.28.331
Cucumis sativusCucsa.319890.1Cucsa.054530.1Cucsa.109660.1.31.349Cucsa.117900.1.24.336Cucsa.193430.1
Cucsa.185070.1.26.345Cucsa.202330.1.62.376Cucsa.096380.1Cucsa.295060.2Cucsa.295060.1
Cucsa.047760.1Cucsa.165390.1.27.338Cucsa.342270.1.29.345Cucsa.042790.1.24.341Cucsa.288710.1.29.347
Cucsa.132200.1
Eucalyptus grandisEucgr.J00497.2Eucgr.J00497.1Eucgr.F03575.1.27.347Eucgr.J00494.1Eucgr.D00293.1
Eucgr.E01067.4Eucgr.E01067.3Eucgr.E01067.2Eucgr.E01067.1Eucgr.A01095.2.24.340
Eucgr.A01095.1.27.343Eucgr.B02365.1Eucgr.A01445.1.38.352Eucgr.B02367.2.28.340Eucgr.B02367.1.28.340
Eucgr.B02364.1Eucgr.F03495.1.24.340Eucgr.G00445.1.33.350Eucgr.C04236.3Eucgr.C04236.2
Eucgr.C04236.1Eucgr.C03710.1.26.344Eucgr.J03064.1Eucgr.J00013.1.24.336Eucgr.F01563.2.28.343
Eucgr.F01563.1.28.343Eucgr.F03494.1Eucgr.J00494.6Eucgr.J00494.5Eucgr.J00494.4
Eucgr.J00494.3Eucgr.J00494.2Eucgr.D01668.1
Fragaria vescamrna03446.1-v1.0-hybrid.28.345mrna15136.1-v1.0-hybrid.26.343mrna31503.1-v1.0-hybrid.26.351mrna21784.1-v1.0-hybridmrna01872.1-v1.0-hybrid
mrna30610.1-v1.0-hybridmrna12825.1-v1.0-hybrid.34.348mrna01212.1-v1.0-hybrid.27.346mrna20426.1-v1.0-hybrid.119.435mrna14081.1-v1.0-hybrid.24.337
mrna11332.1-v1.0-hybrid.26.344mrna15685.1-v1.0-hybridmrna26607.1-v1.0-hybrid.40.349mrna26603.1-v1.0-hybrid.21.329mrna31065.1-v1.0-hybrid
Glycine maxGlyma20g02240.2Glyma20g02240.1Glyma07g34500.2Glyma04g01450.1.30.347Glyma12g31060.2
Glyma12g31060.1Glyma12g09510.3Glyma12g09510.2Glyma13g39261.2Glyma13g39261.1
Glyma14g05300.1.21.338Glyma02g43640.1.21.338Glyma11g18970.2Glyma10g31550.1Glyma14g02350.1.25.343
Glyma02g46330.1.31.348Glyma06g01500.2.31.348Glyma06g01500.1.31.348Glyma15g01030.2Glyma15g01030.1
Glyma17g12180.2Glyma17g12180.1Glyma08g22670.1Glyma12g09510.5Glyma12g09510.4
Glyma15g10050.1Glyma13g22640.1Glyma07g03420.2Glyma13g29000.1Glyma05g35955.1.26.344
Glyma08g03670.1.26.344Glyma14g08200.3Glyma14g08200.2Glyma14g08200.1.32.350Glyma06g07650.2
Glyma18g52860.3Glyma18g52860.2.25.336Glyma18g52860.1.25.336Glyma13g44240.2Glyma13g22640.4
Glyma13g22640.3Glyma12g04800.2.96.319
Gossypium raimondiiGorai.002G114200.1.23.342Gorai.011G084000.1Gorai.008G260000.4Gorai.008G260000.3Gorai.008G260000.2
Gorai.008G260000.1Gorai.006G202300.1.76.390Gorai.007G018900.2Gorai.007G018900.1Gorai.013G263800.1.32.344
Gorai.001G216900.4.25.344Gorai.001G216900.3.25.344Gorai.001G216900.2.25.344Gorai.001G216900.1.25.344Gorai.004G128800.3
Gorai.004G128800.2Gorai.004G128800.1Gorai.004G111800.1Gorai.002G092600.2.25.343Gorai.002G092600.1.25.343
Gorai.009G154800.2Gorai.009G154800.1Gorai.010G062700.1Gorai.001G122300.4Gorai.001G122300.3
Gorai.001G122300.1Gorai.009G442700.1.27.344Gorai.009G085300.9Gorai.009G085300.6Gorai.009G085300.5
Gorai.009G085300.4Gorai.009G085300.3Gorai.009G085300.2Gorai.009G085300.1Gorai.011G044700.2
Gorai.011G044700.1Gorai.006G090600.1.24.341Gorai.005G243100.3Gorai.005G243100.2.24.341Gorai.005G243100.1.24.341
Gorai.001G043100.3Gorai.001G043100.1Gorai.004G282300.2.26.344Gorai.004G282300.1.26.344Gorai.010G078300.1.26.344
Gorai.009G085300.8Gorai.003G121900.1Gorai.009G010800.1.21.335Gorai.011G261000.1Gorai.009G202900.2.28.346
Gorai.009G202900.1.28.346Gorai.010G137300.1Gorai.009G085300.7.158.309Gorai.009G085300.7.158.309Gorai.001G122300.2
Linum usitatissimumLus10004869Lus10020618Lus10001660Lus10028122Lus10017344
Lus10011482Lus10038501Lus10023309Lus10032562.26.343Lus10015151.29.348
Lus10008277Lus10023245.26.342Lus10033244Lus10042825Lus10018306.34.352
Lus10040600.30.348Lus10004391.31.348Lus10016539.25.339Lus10023576.29.346Lus10040461.28.345
Lus10040808.26.340Lus10040294.27.340Lus10012080.28.353Lus10008865.26.339Lus10005166.23.336
Lus10004962.26.341Lus10021088Lus10023120Lus10038099Lus10006659
Lus10016032.26.349
Malus domesticaMDP0000295562.26.342MDP0000646125.28.344MDP0000759591.26.342MDP0000321387.29.360MDP0000147201
MDP0000429251MDP0000404948MDP0000399053.138.452MDP0000228686MDP0000134020
MDP0000660874.33.352MDP0000906277MDP0000480229MDP0000146863.29.346MDP0000259789
MDP0000754160.29.342MDP0000946566MDP0000282531MDP0000231454MDP0000321326.121.441
MDP0000232219.105.423MDP0000630545.27.345MDP0000283032MDP0000797451MDP0000168650
MDP0000147939MDP0000543964.23.332MDP0000676131.23.329MDP0000917991MDP0000301326
Manihot esculentacassava4.1_009801mcassava4.1_009671mcassava4.1_007570m.26.339cassava4.1_006981m.24.343cassava4.1_008551m
cassava4.1_008536mcassava4.1_006146m.34.346cassava4.1_010262mcassava4.1_006972m.24.343cassava4.1_029477m
cassava4.1_028382m.42.357cassava4.1_025555mcassava4.1_006863m.29.345cassava4.1_028137mcassava4.1_030302m.25.338
cassava4.1_007302m.26.343cassava4.1_007157m.27.343cassava4.1_007423m.26.344cassava4.1_007073m.26.344cassava4.1_005968m.34.352
cassava4.1_007509m.27.333cassava4.1_012573mcassava4.1_009600m
Medicago truncatulaMedtr1g007810.1Medtr5g085580.1.25.342Medtr3g080410.1Medtr3g116510.2.28.345Medtr3g116510.1.46.363
Medtr2g086530.1Medtr4g010200.1Medtr4g069940.1.29.346Medtr7g026340.1.23.334Medtr4g114850.2
Medtr4g114850.1Medtr4g083500.1.25.340Medtr4g053140.1
Mimulus guttatusmgv1a005776m.34.350mgv1a008187mmgv1a008785mmgv1a018482mmgv1a004780m
mgv1a005917m.28.345mgv1a006967mmgv1a006001m.26.343mgv1a026651mmgv1a020079m
mgv1a008124mmgv1a008114mmgv1a006258mmgv1a006294m.23.337mgv1a006105m.25.339
mgv1a007888m
Oryza sativaLOC_Os02g33000.1LOC_Os06g34020.1LOC_Os06g04080.2LOC_Os06g04080.1LOC_Os10g07290.1
LOC_Os03g14210.1LOC_Os04g33640.2LOC_Os04g33640.1LOC_Os01g64170.3LOC_Os01g64170.2
LOC_Os01g64170.1LOC_Os02g53200.2.29.350LOC_Os02g53200.1.54.375LOC_Os01g64170.4LOC_Os02g10660.1
LOC_Os06g40490.1LOC_Os07g13580.2LOC_Os07g13580.1LOC_Os11g47820.1.36.354LOC_Os07g35350.3.29.365
LOC_Os07g35350.2.29.365LOC_Os07g35350.1.30.366LOC_Os07g35510.1.30.367LOC_Os08g14700.1.29.366LOC_Os03g46660.1.83.400
LOC_Os03g12620.2LOC_Os03g12620.1LOC_Os05g37130.5LOC_Os05g37130.4LOC_Os05g37130.3
LOC_Os05g37130.2LOC_Os05g37130.1LOC_Os03g51240.3LOC_Os03g51240.2LOC_Os03g51240.1
LOC_Os11g47820.2.36.215LOC_Os11g47820.2.36.215LOC_Os07g35520.1.29.370LOC_Os07g35560.2.27.369LOC_Os07g35560.1.71.413
LOC_Os07g35480.3.29.366LOC_Os07g35480.2.29.366LOC_Os07g35480.1.29.366
Panicum virgatumPavirv00002381mPavirv00002380mPavirv00002379mPavirv00002378mPavirv00002377m
Pavirv00009026mPavirv00003370mPavirv00033704mPavirv00016071m.31.352Pavirv00056586m
Pavirv00041955mPavirv00067366mPavirv00023974mPavirv00060446mPavirv00002452m.31.352
Pavirv00064551mPavirv00054869mPavirv00036742mPavirv00058658mPavirv00053135m
Pavirv00062958mPavirv00046865mPavirv00038234mPavirv00034785mPavirv00064230m
Pavirv00029831m.28.350Pavirv00041735mPavirv00007211mPavirv00041823mPavirv00013502m.27.370
Pavirv00026939mPavirv00050755mPavirv00036780mPavirv00032277mPavirv00068769m
Pavirv00046871mPavirv00025664mPavirv00058680mPavirv00005661m
Physcomitrella patensPp1s150_19V6.1.38.353Pp1s51_57V6.2.37.352Pp1s51_57V6.1.37.352Pp1s6_62V6.2.25.341Pp1s6_62V6.1.25.341
Phaseolus vulgarisPhvul.002G096600.1Phvul.005G123600.1Phvul.008G213400.1.24.343Phvul.L004500.1Phvul.011G094500.1
Phvul.009G097400.1Phvul.008G271000.1.25.342Phvul.005G178000.1Phvul.009G024000.1.27.341Phvul.011G045800.1.26.343
Phvul.002G099500.1.32.348Phvul.006G165100.1Phvul.001G014900.2Phvul.001G014900.1.27.344Phvul.003G166400.1
Phvul.002G307800.1.26.344Phvul.010G155800.1Phvul.011G094500.2Phvul.008G010600.1.25.337
Picea abiesMA_107917g0010MA_67006g0010.30.344MA_82642g0010MA_83329g0010.44.358MA_21822g0010
MA_5603g0010MA_8038g0010.43.361MA_51690g0010.32.349MA_10429401g0010MA_118893g0010
MA_98924g0010MA_9997545g0010MA_10428771g0010MA_10199816g0010
Populus trichocarpaPotri.004G097400.1Potri.002G007300.1.24.344Potri.004G153800.1.24.341Potri.001G449100.5Potri.001G449100.4
Potri.001G449100.3Potri.001G449100.2Potri.001G449100.1Potri.012G017800.2.32.346Potri.012G017800.1.32.346
Potri.011G152400.2Potri.011G152400.1Potri.001G240000.2.27.339Potri.001G240000.1.27.339Potri.010G203800.1
Potri.011G084900.1Potri.014G158400.2.24.343Potri.014G158400.1.24.343Potri.015G010100.3Potri.015G010100.2
Potri.015G010100.1.33.347Potri.008G055900.4Potri.008G055900.3Potri.008G055900.2.29.342Potri.008G055900.1.29.342
Potri.002G224600.4.24.343Potri.002G224600.3.24.343Potri.002G224600.2.24.343Potri.002G224600.1.24.343Potri.009G163700.4
Potri.009G163700.3Potri.009G163700.2Potri.009G163700.1Potri.003G032600.1Potri.001G192200.3
Potri.001G192200.2Potri.001G192200.1Potri.004G202400.1Potri.004G132700.1Potri.008G056000.1.30.342
Potri.009G115400.6Potri.009G115400.4Potri.009G115400.3Potri.009G115400.2.24.340Potri.009G115400.1.24.340
Potri.011G094400.2.31.349Potri.011G094400.1.31.349Potri.002G261800.2.57.374Potri.002G261800.1.57.374Potri.014G185100.1
Potri.014G183800.2Potri.014G183800.1Potri.014G184300.1Potri.014G184100.1Potri.014G182800.1
Potri.014G182500.1Potri.014G182000.2Potri.014G182000.1Potri.014G184900.2Potri.014G184900.1
Potri.014G184600.1Potri.014G182200.1Potri.014G184200.1Potri.006G067500.1Potri.018G129500.4
Potri.018G129500.3Potri.018G129500.2Potri.018G129500.1Potri.014G183500.1Potri.005G253900.1.24.296
Potri.014G184400.1Potri.014G183000.1Potri.014G182700.1
Prunus persicappa005142m.25.355ppa007079mppa006344mppa006239mppa005206m.25.344
ppa005210m.34.351ppa007088mppa007158mppa023079m.32.346ppa004976m.25.342
ppa020393mppa005375m.27.344ppa004320m.33.346ppa1027206m.26.344ppa009389m
ppa005160m.23.322
Ricinus communis30170.m013711.23.34330055.m00156430068.m00259729753.m000250.31.34530003.m000339.28.341
29977.m000251.25.33729948.m000713.24.34329693.m00200530003.m000340.27.34029762.m000502.31.348
29912.m005363.26.34429841.m00285630170.m014027.29.34530190.m010891.28.34429927.m000621
Setaria italicaSi006581mSi019806mSi017035m.31.352Si012113mSi022277m
Si022276mSi022273mSi022272mSi033013mSi017121m
Si000941m.26.362Si001660mSi006506mSi035875mSi035755m
Si006626mSi021971m.31.348Si026317m.30.352Si000908m.29.365Si000851m.28.363
Si001233m.30.378Si035582m.30.347Si035430m.37.354Si026379mSi035791m
Si040122mSi029616m.28.384Si001793m
Selaginella moellendorffii8431110503776182438073.34.35134417
94863.17.335437861.27.33834456
Sorghum bicolorSb10g020900.1Sb04g021700.1Sb06g015590.1Sb09g021800.1Sb04g034530.1.30.351
Sb01g041160.1Sb03g040630.1Sb10g002130.1Sb01g025310.1Sb10g023710.1
Sb06g033250.1.31.347Sb02g007050.1Sb05g027690.1.31.354Sb01g012380.1.37.354Sb02g035490.1.29.379
Sb02g035520.1.25.387Sb02g035480.1.28.388Sb04g006850.1Sb01g041880.1Sb01g009770.1
Sb02g035460.4.33.370Sb02g035460.3.33.370Sb02g035460.2.33.370Sb02g035460.1.33.370
Thellungiella halophilaThhalv10013478m.27.346Thhalv10026799m.28.347Thhalv10004182m.37.351Thhalv10007753mThhalv10007671m
Thhalv10027777mThhalv10027775mThhalv10002515m.25.344Thhalv10025369mThhalv10024968m.26.343
Thhalv10016788mThhalv10016756mThhalv10003213mThhalv10022641m.41.358Thhalv10020865m
Thhalv10002343mThhalv10002342mThhalv10002341mThhalv10010363m.30.342Thhalv10008089m
Thhalv10017897m.30.338Thhalv10002844m
Vitis viniferaGSVIVT01013401001.49.369GSVIVT01038583001.24.338GSVIVT01021499001GSVIVT01036124001GSVIVT01031959001.59.377
GSVIVT01037711001.24.342GSVIVT01009700001.28.345GSVIVT01017331001GSVIVT01024956001GSVIVT01016553001.28.202
GSVIVT01016553001.28.202GSVIVT01019678001.99.280GSVIVT01019678001.99.280GSVIVT01030503001.124.253GSVIVT01030503001.124.253
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)