y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma10g32640.2
FamilyAA3
Protein PropertiesLength: 682 Molecular Weight: 74900.5 Isoelectric Point: 8.0265
ChromosomeChromosome/Scaffold: 10 Start: 41068727 End: 41070916
Descriptionfatty alcohol oxidase 3
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA31626760
  IDSKNNTLNIKCDVVIVGSGCGGGVAASILASSGLKVLVLEKGNYFTPNDYSSLEGPSLNELYELGGTFASRDGKMAILTGTTVGGGSAVNWAASIRTPD
  FVLEEWGKDHKLSLFSSHEYLSAMDMVCKRIGVTDKCIEEGLQNQVLRKGCKNLGLPVDYVPRNSSERHYCGSCNYGCTRGEKQGTEVTWLVDAVDHGAV
  ILTGTKAERFILGKKNKGGGVRRKKCLGVMANVVTNNITWRLKVEAKVTVSACGALFTPPLMISSGLKNKHIGKNLHLHPVLMSWGYFPDSNSELKGKCY
  EGGIITSVHKVVSEDYSKVKAIVETPALGPGALSTLIPWVSGLDFKDRMLKYSRTVHLITIIRDMGCGEVRSEGRVHYELDESDKENIRDGVKQALRILI
  AAGAVEVGTHRSDGHRIECNGKNEKELERFVESVYATEGLMSHEEKWSIYSSAHQMGSCRMGMSEKEGAVDENGMSWEAEGLFVCDASLLPTAIGVNPMI
  TIQSTAYCVAKRIAA
Full Sequence
Protein Sequence     Length: 682     Download
MNTLSVFGMI AEILIKRALK EALILLRVIL WLLSTRLGTL LLCGTLCLSK KWPFINSFSN    60
LSLDNREKVL QKWFKHRFLT PIRLVFIYIK VLCFFVFFSQ CDDNGENPAW EAIGYQVDSD    120
GITTTSNVHR ERPLEKGIVE AMKESNLSLP KSLIEKGLEV AIDSKNNTLN IKCDVVIVGS    180
GCGGGVAASI LASSGLKVLV LEKGNYFTPN DYSSLEGPSL NELYELGGTF ASRDGKMAIL    240
TGTTVGGGSA VNWAASIRTP DFVLEEWGKD HKLSLFSSHE YLSAMDMVCK RIGVTDKCIE    300
EGLQNQVLRK GCKNLGLPVD YVPRNSSERH YCGSCNYGCT RGEKQGTEVT WLVDAVDHGA    360
VILTGTKAER FILGKKNKGG GVRRKKCLGV MANVVTNNIT WRLKVEAKVT VSACGALFTP    420
PLMISSGLKN KHIGKNLHLH PVLMSWGYFP DSNSELKGKC YEGGIITSVH KVVSEDYSKV    480
KAIVETPALG PGALSTLIPW VSGLDFKDRM LKYSRTVHLI TIIRDMGCGE VRSEGRVHYE    540
LDESDKENIR DGVKQALRIL IAAGAVEVGT HRSDGHRIEC NGKNEKELER FVESVYATEG    600
LMSHEEKWSI YSSAHQMGSC RMGMSEKEGA VDENGMSWEA EGLFVCDASL LPTAIGVNPM    660
ITIQSTAYCV AKRIAAFLKI E*                                             720
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR02462pyranose_ox0.00961567965+
TIGR03970Rv06975.0e-561267868+
pfam05199GMC_oxred_C2.0e-23536668133+
COG2303BetA4.0e-27191676545+
pfam00732GMC_oxred_N5.0e-81222442224+
Gene Ontology
GO TermDescription
GO:0009055electron carrier activity
GO:0016491oxidoreductase activity
GO:0016614oxidoreductase activity, acting on CH-OH group of donors
GO:0050660flavin adenine dinucleotide binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN71289.101167972736hypothetical protein [Vitis vinifera]
EMBLCAP15762.101067976745long chain fatty alcohol oxidase FAO1 [Lotus japonicus]
RefSeqXP_002285334.101167972736PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002311685.101067977742predicted protein [Populus trichocarpa]
RefSeqXP_002314488.101067849713predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3t37_A0.00000217265317499A Chain A, Crystal Structure Of Pyridoxine 4-Oxidase From Mesorbium Loti
PDB2gew_A0.005615674442496A Chain A, Crystal Structure Of Pyridoxine 4-Oxidase From Mesorbium Loti
PDB1n4w_A0.005615674442496A Chain A, Crystal Structure Of Pyridoxine 4-Oxidase From Mesorbium Loti
PDB1n4v_A0.005615674442496A Chain A, Crystal Structure Of Pyridoxine 4-Oxidase From Mesorbium Loti
PDB1n4u_A0.005615674442496A Chain A, Crystal Structure Of Pyridoxine 4-Oxidase From Mesorbium Loti
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO794753633506820
HO7792244641446070
FG9004082362584930
EX2751362863876720
FG8355212174626780
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_089_00009.1Aquca_049_00132.1Aquca_034_00307.1Aquca_034_00304.1
Arabidopsis lyrata914728491906479855470376
Arabidopsis thalianaAT4G19380.1AT4G28570.1AT3G23410.1AT1G03990.1
Brachypodium distachyonBradi3g28677.1Bradi3g28657.1Bradi3g49085.1
Brassica rapaBra012548Bra024190Bra013391Bra015283Bra001912
Bra014947
Carica papayaevm.model.supercontig_165.33evm.model.supercontig_44.31evm.model.supercontig_2124.1
Capsella rubellaCarubv10004418mCarubv10004208mCarubv10012453mCarubv10004212mCarubv10013046m
Citrus clementinaCiclev10011111mCiclev10004403mCiclev10004405mCiclev10018992m
Citrus sinensisorange1.1g003990morange1.1g004496m
Cucumis sativusCucsa.037200.2Cucsa.037200.1Cucsa.035240.1Cucsa.255570.1
Eucalyptus grandisEucgr.H03017.2Eucgr.H03017.1Eucgr.H00753.1Eucgr.K02114.1Eucgr.D02566.1
Eucgr.D02568.1
Fragaria vescamrna08288.1-v1.0-hybridmrna11513.1-v1.0-hybridmrna08285.1-v1.0-hybrid
Glycine maxGlyma09g35210.2Glyma01g35620.1Glyma16g16415.1Glyma16g08300.2Glyma12g15940.1
Glyma19g34960.1Glyma06g42400.2Glyma03g32220.2
Gossypium raimondiiGorai.001G179800.3Gorai.001G179800.2Gorai.001G179800.1Gorai.011G177100.3Gorai.011G177100.2
Gorai.011G177100.1Gorai.006G252500.1
Linum usitatissimumLus10003621Lus10024922Lus10035673Lus10008239Lus10022903
Lus10037257Lus10011800
Malus domesticaMDP0000233110MDP0000173300MDP0000208936MDP0000197715
Manihot esculentacassava4.1_004067mcassava4.1_002349mcassava4.1_002619mcassava4.1_002379mcassava4.1_025870m
Medicago truncatulaMedtr5g025650.1Medtr8g072210.1Medtr4g081080.1Medtr1g075650.1Medtr4g080890.1
Mimulus guttatusmgv1a001761mmgv1a022390mmgv1a001868mmgv1a001883mmgv1a001896m
Oryza sativaLOC_Os10g33540.1LOC_Os10g33520.1LOC_Os10g33460.1LOC_Os02g40840.1
Panicum virgatumPavirv00054947m
Physcomitrella patensPp1s58_61V6.1Pp1s7_216V6.1Pp1s48_250V6.1Pp1s2_413V6.1
Phaseolus vulgarisPhvul.002G122600.1Phvul.003G278200.1Phvul.007G124200.1Phvul.001G162800.1Phvul.011G136600.1
Picea abiesMA_10427118g0010MA_9032943g0010MA_9483g0010MA_10427421g0010MA_242814g0010
Populus trichocarpaPotri.004G234900.2Potri.004G234900.1Potri.010G069100.1Potri.008G169300.1Potri.002G259700.1
Prunus persicappa014756mppa018458mppa021498m
Ricinus communis29827.m00265529981.m00058628492.m000467
Setaria italicaSi034362mSi034354mSi034359mSi016380m
Selaginella moellendorffii1140891168557460173531
Sorghum bicolorSb01g019470.1Sb01g019460.1Sb01g019480.1Sb04g026370.1Sb04g026390.1
Thellungiella halophilaThhalv10024717mThhalv10024496mThhalv10024528mThhalv10020141mThhalv10006882m
Vitis viniferaGSVIVT01036891001GSVIVT01027855001GSVIVT01028371001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)