y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma10g36310.1
FamilyAA1
Protein PropertiesLength: 565 Molecular Weight: 63296.3 Isoelectric Point: 8.5126
ChromosomeChromosome/Scaffold: 10 Start: 44518703 End: 44522393
DescriptionLaccase/Diphenol oxidase family protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA1265510
  SHYSFVVREANYTRLCSTKSILTVNGNFPGPTIKVHRGETIFVNVYNKGNYNITLHWHGVKQPRNPWTDGPAYITQCPIQPGRRFRQKLIFSTEEGTIWW
  HAHSDWSRATIHGAIYVYPTKNTPYPFPKAHAEIPIIFSEWWKSDINEVFTQFIESGGGPNISDALTINGQPGDLYPCSMTETFEFHVEQGRTYLLRVVN
  AAMNLILFFSVSKHNLTVVGADGMLTKPLTREYICISPGQTMDVLLHANQEPDHYYLAARAYSSGVGVAFDNTTTTARVKYSGNYTPPSSPSLPNLPDFN
  DTPAVLDFITSLRGLPERYPRQVPTNITTQIVTTISVNTLPCPNGRTCQGPNGTIFAASMNNISFDTPNIDILKAYYYHINGVFKPGFPRFPPFIFNFTG
  DFLPITLNIPKQGTRVNVLNYGATVEIVFQGTNVIAGIDHPMHLHGFSFHVVGYGLGNFNQSKDPKNFNLVDPPYLNTVIVPVNGWAAVRFVATNPGVWF
  MHCHLERHQVWGMETVFIVKNGKASN
Full Sequence
Protein Sequence     Length: 565     Download
MSFGKKLFLQ ILWWFSLIGL SSQIRSHYSF VVREANYTRL CSTKSILTVN GNFPGPTIKV    60
HRGETIFVNV YNKGNYNITL HWHGVKQPRN PWTDGPAYIT QCPIQPGRRF RQKLIFSTEE    120
GTIWWHAHSD WSRATIHGAI YVYPTKNTPY PFPKAHAEIP IIFSEWWKSD INEVFTQFIE    180
SGGGPNISDA LTINGQPGDL YPCSMTETFE FHVEQGRTYL LRVVNAAMNL ILFFSVSKHN    240
LTVVGADGML TKPLTREYIC ISPGQTMDVL LHANQEPDHY YLAARAYSSG VGVAFDNTTT    300
TARVKYSGNY TPPSSPSLPN LPDFNDTPAV LDFITSLRGL PERYPRQVPT NITTQIVTTI    360
SVNTLPCPNG RTCQGPNGTI FAASMNNISF DTPNIDILKA YYYHINGVFK PGFPRFPPFI    420
FNFTGDFLPI TLNIPKQGTR VNVLNYGATV EIVFQGTNVI AGIDHPMHLH GFSFHVVGYG    480
LGNFNQSKDP KNFNLVDPPY LNTVIVPVNG WAAVRFVATN PGVWFMHCHL ERHQVWGMET    540
VFIVKNGKAS NETLPPPPPD MPLC*                                          600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR03390ascorbOXfungal9.0e-5232546558+
PLN02604PLN026045.0e-656542590+
PLN02191PLN021911.0e-6511554588+
TIGR03388ascorbase4.0e-8126542549+
TIGR03389laccase027564539+
Gene Ontology
GO TermDescription
GO:0005507copper ion binding
GO:0016491oxidoreductase activity
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACU17753.1015643566unknown [Glycine max]
RefSeqXP_002264394.1015641567PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002272618.1035479545PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002272689.1015541557PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002307538.1015501553predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1asq_B0225421521A Chain A, The Xylanase Ta From Thermoascus Aurantiacus Utilizes Arabinose Decorations Of Xylan As Significant Substrate Specificity Determinants
PDB1asq_A0225421521A Chain A, The Xylanase Ta From Thermoascus Aurantiacus Utilizes Arabinose Decorations Of Xylan As Significant Substrate Specificity Determinants
PDB1asp_B0225421521A Chain A, The Xylanase Ta From Thermoascus Aurantiacus Utilizes Arabinose Decorations Of Xylan As Significant Substrate Specificity Determinants
PDB1asp_A0225421521A Chain A, The Xylanase Ta From Thermoascus Aurantiacus Utilizes Arabinose Decorations Of Xylan As Significant Substrate Specificity Determinants
PDB1aso_B0225421521A Chain A, The Xylanase Ta From Thermoascus Aurantiacus Utilizes Arabinose Decorations Of Xylan As Significant Substrate Specificity Determinants
Signal Peptide
Cleavage Site
23
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EV2669132732094800
HO797675499705650
EE59197959685600
CB97447629712950
CV53150823332340
Orthologous Group
SpeciesID
Arabidopsis lyrata917686487747
Arabidopsis thalianaAT5G48100.1AT5G09360.1
Brachypodium distachyonBradi3g59210.1Bradi3g59187.1
Brassica rapaBra020720Bra037510
Capsella rubellaCarubv10027828mCarubv10000589m
Citrus clementinaCiclev10003795m
Citrus sinensisorange1.1g036841m
Cucumis sativusCucsa.345760.1
Eucalyptus grandisEucgr.L01441.1Eucgr.J00889.1Eucgr.F02650.1Eucgr.H04936.1Eucgr.F04163.1
Eucgr.F02674.1Eucgr.H04937.1Eucgr.F02648.1Eucgr.F02642.1Eucgr.F02646.1
Eucgr.L00623.1Eucgr.B01273.1Eucgr.H02579.1Eucgr.F02649.1Eucgr.F04160.1
Eucgr.F04162.1Eucgr.F02641.1Eucgr.F04154.1Eucgr.L01656.1Eucgr.F02644.1
Eucgr.L00621.1Eucgr.C02745.1Eucgr.J00888.1Eucgr.F02652.2Eucgr.F02652.1
Eucgr.L01343.1Eucgr.L02310.1Eucgr.E04216.1Eucgr.G00841.1Eucgr.E04217.1
Eucgr.E04220.1Eucgr.E04219.1Eucgr.E04218.1Eucgr.E04221.1Eucgr.L01345.1
Eucgr.E03935.1Eucgr.F04158.1Eucgr.F02653.1Eucgr.E03932.1Eucgr.F04157.1
Eucgr.F02642.2Eucgr.F02649.2
Fragaria vescamrna16187.1-v1.0-hybridmrna27556.1-v1.0-hybridmrna27557.1-v1.0-hybridmrna27526.1-v1.0-hybridmrna27527.1-v1.0-hybrid
mrna27523.1-v1.0-hybridmrna15091.1-v1.0-hybridmrna27531.1-v1.0-hybridmrna24290.1-v1.0-hybridmrna27522.1-v1.0-hybrid
mrna17621.1-v1.0-hybridmrna11910.1-v1.0-hybridmrna24296.1-v1.0-hybridmrna05430.1-v1.0-hybridmrna24295.1-v1.0-hybrid
mrna02152.1-v1.0-hybridmrna24292.1-v1.0-hybridmrna08067.1-v1.0-hybridmrna11940.1-v1.0-hybrid
Glycine maxGlyma11g36058.1Glyma16g27480.1Glyma10g36320.1Glyma20g31280.1Glyma20g31270.1
Gossypium raimondiiGorai.009G260400.1Gorai.009G260400.2Gorai.005G076600.2Gorai.005G076600.1Gorai.005G076600.3
Gorai.009G260600.1Gorai.009G261300.1Gorai.009G261000.1Gorai.009G260800.1Gorai.010G130100.1
Gorai.009G260400.3Gorai.009G261100.1Gorai.009G261500.1
Linum usitatissimumLus10041067Lus10026812Lus10036070Lus10041066
Malus domesticaMDP0000546342MDP0000143780MDP0000168293MDP0000318606MDP0000262848
MDP0000090732MDP0000242301MDP0000252988MDP0000724206MDP0000419919
MDP0000188477MDP0000263468MDP0000148967
Manihot esculentacassava4.1_028126mcassava4.1_005540mcassava4.1_026478mcassava4.1_027769m
Medicago truncatulaMedtr3g101640.1.30.558Medtr3g101640.1.30.558Medtr2g008330.1
Mimulus guttatusmgv1a018195mmgv1a019066mmgv1a021399mmgv1a003690mmgv1a004060m
Oryza sativaLOC_Os02g51440.1LOC_Os11g47390.1
Panicum virgatumPavirv00068445mPavirv00039877mPavirv00029470mPavirv00044315mPavirv00029948m
Phaseolus vulgarisPhvul.004G086400.1Phvul.007G086400.1Phvul.007G086500.1Phvul.004G087000.1
Populus trichocarpaPotri.005G200600.1Potri.005G200500.1Potri.011G071100.1Potri.019G088900.1Potri.019G088500.1
Potri.019G088600.1Potri.019G088800.1Potri.019G088700.1Potri.019G088700.2Potri.005G200700.1
Potri.001G206200.1Potri.005G200500.2Potri.005G200600.2
Prunus persicappa016123mppa003529mppa003546mppa016865mppa015996m
ppa025323mppa003489mppa014804mppa003580mppa003663m
ppa003583mppa025087m
Ricinus communis28644.m00090929703.m00152429703.m00152729703.m00153128660.m000189
29703.m00153028644.m00094028644.m00093728644.m000938
Setaria italicaSi016752mSi007952mSi019864mSi019724m
Sorghum bicolorSb04g027860.1Sb04g034620.1Sb04g034610.1Sb04g027850.1Sb10g030340.1
Sb05g022480.1
Thellungiella halophilaThhalv10003921mThhalv10015612m
Vitis viniferaGSVIVT01001603001GSVIVT01012329001GSVIVT01013689001GSVIVT01013695001GSVIVT01013694001
GSVIVT01012332001GSVIVT01034783001GSVIVT01012343001GSVIVT01034842001GSVIVT01034817001
GSVIVT01001604001GSVIVT01001614001GSVIVT01012346001GSVIVT01013687001.321.754GSVIVT01013687001.321.754
GSVIVT01012359001GSVIVT01034828001GSVIVT01013692001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)