y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma10g40690.4
FamilyGH95
Protein PropertiesLength: 689 Molecular Weight: 76838.1 Isoelectric Point: 6.8856
ChromosomeChromosome/Scaffold: 10 Start: 48019967 End: 48026432
Description1,2-alpha-L-fucosidases
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH95656760
  RPLKVTFAEPATHWTDAIPIGNGRLGAMVWGAVPSEALQLNEDTLWTGIPGDYTNKSAPQALAEVRKLVNDRKFAEATAAAVKLSGEPSDVFQLLGDIKL
  EFHDSHLNYSKESYYRELDLDTATAKIKYSVGDVEFTREHFASNPDQVIVTRLSASKPGSLSFTVYFDSKMHHDSRVSGQNQIKIEGRCPGSRIRPRVNS
  IDNPQGIQFSAVLDMQISKDKGVIHVLDDKKLRVEGSDSAILLLTASSSFDGPFTKPEDSKKDPASESLSRMVSVKKFSYDDLYARHLADYQNLFHRVSL
  QLSKSSKTGSGKSVLEGRKLVSSQTNISQKRGDDTIPTSARVKSFQTDEDPSFVELLFQYGRYLLISCSRPGTQVANLQGIWNKDVEPAWDGAPHLNINL
  QMNYWPSLACNLHECQEPLFDFISSLSVIGKKTAKVNYEANGWVAHQVSDIWGKTSPDRGEAVWALWPMGGAWLCTHLWEHYIYTMDKDFLKNKAYPLLE
  GCTTFLLDWLIEGRGGLLETNPSTSPEHMFTAPDGKTASVSYSSTMDISIIKEVFSMIISAAEVLGRHNDTIIKRVTKYQSKLPPTKVARDGSIMEWEMM
  VQGGQQLGKLHC
Full Sequence
Protein Sequence     Length: 689     Download
MATANRHSYE LLLLHRLLLY FVVSCSLSLS WAVQDGERVM VRNTPQKNWW KPSLTNAEDD    60
DPPPRPLKVT FAEPATHWTD AIPIGNGRLG AMVWGAVPSE ALQLNEDTLW TGIPGDYTNK    120
SAPQALAEVR KLVNDRKFAE ATAAAVKLSG EPSDVFQLLG DIKLEFHDSH LNYSKESYYR    180
ELDLDTATAK IKYSVGDVEF TREHFASNPD QVIVTRLSAS KPGSLSFTVY FDSKMHHDSR    240
VSGQNQIKIE GRCPGSRIRP RVNSIDNPQG IQFSAVLDMQ ISKDKGVIHV LDDKKLRVEG    300
SDSAILLLTA SSSFDGPFTK PEDSKKDPAS ESLSRMVSVK KFSYDDLYAR HLADYQNLFH    360
RVSLQLSKSS KTGSGKSVLE GRKLVSSQTN ISQKRGDDTI PTSARVKSFQ TDEDPSFVEL    420
LFQYGRYLLI SCSRPGTQVA NLQGIWNKDV EPAWDGAPHL NINLQMNYWP SLACNLHECQ    480
EPLFDFISSL SVIGKKTAKV NYEANGWVAH QVSDIWGKTS PDRGEAVWAL WPMGGAWLCT    540
HLWEHYIYTM DKDFLKNKAY PLLEGCTTFL LDWLIEGRGG LLETNPSTSP EHMFTAPDGK    600
TASVSYSSTM DISIIKEVFS MIISAAEVLG RHNDTIIKRV TKYQSKLPPT KVARDGSIME    660
WEMMVQGGQQ LGKLHCGHIF TIVSTHIA*                                      720
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqXP_002270199.10336861653PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002298754.106568610615predicted protein [Populus trichocarpa]
RefSeqXP_002313154.10586864610predicted protein [Populus trichocarpa]
RefSeqXP_002313157.10336861647predicted protein [Populus trichocarpa]
RefSeqXP_002527476.10346864656conserved hypothetical protein [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2rdy_B0676613574A Chain A, Crystal Structure Of A Putative Glycoside Hydrolase Family Protein From Bacillus Halodurans
PDB2rdy_A0676613574A Chain A, Crystal Structure Of A Putative Glycoside Hydrolase Family Protein From Bacillus Halodurans
PDB2eae_A08263051597A Chain A, Crystal Structure Of 1,2-A-L-Fucosidase From Bifidobacterium Bifidum In Complexes With Products
PDB2eac_B08263052598A Chain A, Crystal Structure Of 1,2-A-L-Fucosidase From Bifidobacterium Bifidum In Complexes With Products
PDB2eac_A08263052598A Chain A, Crystal Structure Of 1,2-A-L-Fucosidase From Bifidobacterium Bifidum In Complexes With Products
Transmembrane Domains
StartEnd
1234
Signal Peptide
Cleavage Site
32
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
BW65311528012800
CV5304922921033940
GT6269522743255980
ES8394922764096840
DY275135374714440
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_083_00007.1Aquca_083_00007.2Aquca_083_00007.3Aquca_083_00007.4Aquca_083_00007.5
Aquca_083_00007.6
Arabidopsis lyrata912968
Arabidopsis thalianaAT4G34260.1
Brachypodium distachyonBradi1g28366.1Bradi3g25226.2Bradi3g25226.1
Brassica rapaBra011514
Carica papayaevm.model.supercontig_106.113
Capsella rubellaCarubv10004274m
Citrus clementinaCiclev10027816mCiclev10027838mCiclev10027896mCiclev10027914m
Citrus sinensisorange1.1g003571morange1.1g003209morange1.1g004833morange1.1g004823morange1.1g007147m
orange1.1g007141morange1.1g007204morange1.1g010926morange1.1g012384m
Cucumis sativusCucsa.108860.1
Eucalyptus grandisEucgr.I01092.1Eucgr.I01093.1Eucgr.I01092.2Eucgr.I01091.1Eucgr.I01092.3
Fragaria vescamrna22851.1-v1.0-hybrid.28.414mrna22851.1-v1.0-hybrid.28.414mrna22843.1-v1.0-hybrid.28.420mrna22843.1-v1.0-hybrid.28.420mrna22843.1-v1.0-hybrid.490.804
mrna22843.1-v1.0-hybrid.490.804mrna22851.1-v1.0-hybrid.412.731mrna22851.1-v1.0-hybrid.412.731
Glycine maxGlyma20g26646.1Glyma10g40690.1Glyma20g26653.1Glyma01g45470.1Glyma10g40690.2
Glyma10g40690.3Glyma01g45470.2
Gossypium raimondiiGorai.008G022000.1Gorai.008G022200.1Gorai.008G022200.3Gorai.008G022200.2Gorai.008G022000.2
Gorai.008G022000.3
Linum usitatissimumLus10020979Lus10026594Lus10029689Lus10013884Lus10026595.318.693
Lus10026595.318.693Lus10026595.49.314Lus10026595.49.314
Malus domesticaMDP0000212784MDP0000623980MDP0000623979
Manihot esculentacassava4.1_001723mcassava4.1_005093mcassava4.1_008652mcassava4.1_021629m
Medicago truncatulaMedtr4g127370.1
Mimulus guttatusmgv1a001249m
Oryza sativaLOC_Os10g19334.1LOC_Os10g19880.1LOC_Os10g19334.2
Panicum virgatumPavirv00068345mPavirv00058326mPavirv00053527mPavirv00056040mPavirv00052622m
Pavirv00070327mPavirv00065921m
Physcomitrella patensPp1s174_46V6.2.375.814Pp1s174_46V6.2.375.814Pp1s174_46V6.1.375.814Pp1s174_46V6.1.375.814Pp1s11165_1V6.1
Phaseolus vulgarisPhvul.007G041400.1Phvul.002G053000.1
Picea abiesMA_6830674g0010MA_10427365g0010
Populus trichocarpaPotri.009G093900.1Potri.001G299000.6Potri.001G299000.1Potri.009G093500.1Potri.001G298900.1
Potri.001G299000.4Potri.009G093500.3Potri.001G298900.2Potri.001G299000.9Potri.001G299000.7
Potri.009G093500.2Potri.001G299000.5Potri.001G299000.2Potri.001G299000.3Potri.001G299000.11
Potri.009G093500.4Potri.001G299000.10Potri.001G299000.8Potri.001G299000.12
Prunus persicappa001398m
Ricinus communis28152.m00088228152.m000881
Setaria italicaSi040042mSi035391mSi040167mSi037248mSi037505m
Selaginella moellendorffii171005
Sorghum bicolorSb02g007180.1
Thellungiella halophilaThhalv10024398m
Vitis viniferaGSVIVT01037900001.265.748GSVIVT01037900001.265.748GSVIVT01037900001.32.242GSVIVT01037900001.32.242
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)