y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma10g41010.1
FamilyAA1
Protein PropertiesLength: 576 Molecular Weight: 65408.8 Isoelectric Point: 9.1197
ChromosomeChromosome/Scaffold: 10 Start: 48210301 End: 48215887
DescriptionCupredoxin superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA1903464.1e-23
  ATVPGPTIEALYGVDTHVRWQNHLPPKHILPWDPTIPTAMTNSTRGIPTVVHLHGGIHAPESDGNANAWFTSKFNQRGPTWTKKTYHYPNNQQPGNLWYH
  DHAMGLTRVNLLAGLLGAYIIRHPEIEDPLGLPSGDEFDRTLIVFDRSFRTDGSIFMSSIGNNPKIHPQWQPEYFGDAIIVNGKAWPRLTVRRRKYRFRI
  INASNARFFRFFFSNGLRFTHVASDSAYIEKPVTANETLVGPSEITDIVVDFSRSKS
Full Sequence
Protein Sequence     Length: 576     Download
MGKRTLLLKL LTLVSLLGCS SASDHLVNVS KLEMFVDELP HMPRILGYHL SDGVPRSKSF    60
KIGMFKKKWK FHKDLPPTTV YAFGTSKHTA TVPGPTIEAL YGVDTHVRWQ NHLPPKHILP    120
WDPTIPTAMT NSTRGIPTVV HLHGGIHAPE SDGNANAWFT SKFNQRGPTW TKKTYHYPNN    180
QQPGNLWYHD HAMGLTRVNL LAGLLGAYII RHPEIEDPLG LPSGDEFDRT LIVFDRSFRT    240
DGSIFMSSIG NNPKIHPQWQ PEYFGDAIIV NGKAWPRLTV RRRKYRFRII NASNARFFRF    300
FFSNGLRFTH VASDSAYIEK PVTANETLVG PSEITDIVVD FSRSKSDVAI LANDAKYPYP    360
SGDPVNEANG KVIKFIIIPD HDQQLHTSRL PKRFLEYPLL DLSSVTHTRY VAMYEYASDI    420
DEPTHLYLNA KPYEAPATEN PKVGSTELWY VINLTEDNHP LHIHLGLFKV LDQTELVKPH    480
DEFTECMTKI NDAVKCHVDK YARGKKIEVP AHEKGWKNVF KMMPGHVTKV AVRFSYIHTN    540
ASYAFDATTE PGYVYHCHVL DHEDNAMMRP LKIIK*                              600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam07731Cu-oxidase_21.0e-6423573164+
PRK10965PRK109659.0e-9428568145+
PRK10965PRK109659.0e-10137346219+
pfam07732Cu-oxidase_34.0e-1078214150+
COG2132SufI7.0e-3189573495+
Gene Ontology
GO TermDescription
GO:0005507copper ion binding
GO:0016491oxidoreductase activity
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN78466.102457525573hypothetical protein [Vitis vinifera]
EMBLCBI26921.101557597654unnamed protein product [Vitis vinifera]
RefSeqXP_002284144.101557520577PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002315892.102357424572predicted protein [Populus trichocarpa]
RefSeqXP_002531069.1045753575spore coat protein, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3zdw_A0325733508A Chain A, The Structure Of Soybean Peroxidase
PDB2x88_A0325733508A Chain A, The Structure Of Soybean Peroxidase
PDB2x87_A0325733508A Chain A, Crystal Structure Of The Reconstituted Cota
PDB2bhf_A0325733508A Chain A, Crystal Structure Of The Reconstituted Cota
PDB1w8e_A0325733508A Chain A, Crystal Structure Of The Reconstituted Cota
Signal Peptide
Cleavage Site
22
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO778093522555760
HO7965214601175760
BW656235238182540
ES833412310193280
EL443532295693630
Orthologous Group
SpeciesID
Arabidopsis lyrata472551
Brassica rapaBra024558Bra016163
Carica papayaevm.model.supercontig_65.123
Capsella rubellaCarubv10020039m
Eucalyptus grandisEucgr.B00864.1Eucgr.B00863.1Eucgr.B00862.1
Glycine maxGlyma20g26270.3Glyma20g26270.2Glyma20g26270.1
Gossypium raimondiiGorai.005G162700.1
Manihot esculentacassava4.1_004784m
Mimulus guttatusmgv1a004781m
Oryza sativaLOC_Os01g03640.1LOC_Os01g03630.1LOC_Os01g03620.1LOC_Os01g03530.2LOC_Os01g03530.1
Panicum virgatumPavirv00060261mPavirv00051027mPavirv00039074m
Physcomitrella patensPp1s40_48V6.1Pp1s40_48V6.2Pp1s40_48V6.3Pp1s40_48V6.4Pp1s40_48V6.5
Pp1s40_48V6.6
Phaseolus vulgarisPhvul.007G038200.1
Picea abiesMA_64691g0010MA_10432589g0010
Setaria italicaSi005198mSi004323m
Selaginella moellendorffii90700
Sorghum bicolorSb03g007440.1
Thellungiella halophilaThhalv10007182m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny