y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma10g43710.1
FamilyGH20
Protein PropertiesLength: 544 Molecular Weight: 61297.2 Isoelectric Point: 8.1081
ChromosomeChromosome/Scaffold: 10 Start: 50287818 End: 50294190
Descriptionbeta-hexosaminidase 1
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH201834920
  LDKPRFPYRGLMLDTSRHYLPVDVIKQIIESMSYAKLNVLHWHIIDEQSFPLEVPTYPNLWKGSYTKWERYTVEDAYEIVNFSKMRGINVMAEVDVPGHA
  ASWGIGYPDLWPSPSCKEPLDVSKKFTFDVLSGILTDMRKIFPFELFHLGGDEVNTDCWTNTSTVNKWLRNHNMTAKDAYQYFVLKAQNIALTKNWSPVN
  WEETFNTFPTKLHPRTVVHNWLGPGVCPKAVAKGFRCIFSNQGVWYLDHLDVPWDDVYTAEPLEGIRKASEQKLVLGGEVCMWGETADTSDVQQTIWPRA
  AAAAERLWSR
Full Sequence
Protein Sequence     Length: 544     Download
MGLLCIPISS SVLQTLFLFC SAFFVSQALG ARIPQPHKPL PFIWPLPAKF SFGNDSLSVD    60
PALSLSGNGA ASAIVRDAFH RYKGILFKHG DRFSFLRTPR PVYDVTRLSI NVHSHSEELQ    120
LGVDESYNLF VSRAQALSGA GQVTIEANTV FGALRGLETF SQLCSFDYTT KTVQIYKAPW    180
SILDKPRFPY RGLMLDTSRH YLPVDVIKQI IESMSYAKLN VLHWHIIDEQ SFPLEVPTYP    240
NLWKGSYTKW ERYTVEDAYE IVNFSKMRGI NVMAEVDVPG HAASWGIGYP DLWPSPSCKE    300
PLDVSKKFTF DVLSGILTDM RKIFPFELFH LGGDEVNTDC WTNTSTVNKW LRNHNMTAKD    360
AYQYFVLKAQ NIALTKNWSP VNWEETFNTF PTKLHPRTVV HNWLGPGVCP KAVAKGFRCI    420
FSNQGVWYLD HLDVPWDDVY TAEPLEGIRK ASEQKLVLGG EVCMWGETAD TSDVQQTIWP    480
RAAAAAERLW SRRDSTSGNV NIIALPRLHY FRCLLNRRGI PAAPVKNFIA RTAPVGPGSC    540
FEQ*                                                                 600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd02742GH20_hexosaminidase2.0e-61190491323+
cd06563GH20_chitobiase-like2.0e-69188491350+
cd06570GH20_chitobiase-like_12.0e-71188496325+
pfam00728Glyco_hydro_208.0e-99188491334+
cd06562GH20_HexA_HexB-like5.0e-146188519352+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0004563beta-N-acetylhexosaminidase activity
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAE99290.1085431541beta-N-acetylhexosaminidase -like protein [Arabidopsis thaliana]
EMBLCAB75760.1085431557beta-N-acetylhexosaminidase-like protein [Arabidopsis thaliana]
RefSeqNP_567017.2085431541HEXO1 (BETA-HEXOSAMINIDASE 1); beta-N-acetylhexosaminidase/ hexosaminidase/ hydrolase, hydrolyzing O-glycosyl compounds [Arabidopsis thaliana]
RefSeqXP_002282535.1045431541PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002316315.10115433531predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3lmy_B02252534546A Chain A, The Crystal Structure Of Beta-Hexosaminidase B In Complex With Pyrimethamine
PDB3lmy_A02252534546A Chain A, The Crystal Structure Of Beta-Hexosaminidase B In Complex With Pyrimethamine
PDB1o7a_F0305251505A Chain A, Human Beta-Hexosaminidase B
PDB1o7a_E0305251505A Chain A, Human Beta-Hexosaminidase B
PDB1o7a_D0305251505A Chain A, Human Beta-Hexosaminidase B
Metabolic Pathways
Pathway NameReactionECProtein Name
chitin degradation IIRXN-12625EC-3.2.1.52β-L-N-acetylhexosaminidase
chitin degradation IIRXN-12626EC-3.2.1.52β-L-N-acetylhexosaminidase
Signal Peptide
Cleavage Site
30
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO8039823981475440
FC9080992892074950
DY2671843082075130
EX2645202911704600
DY267184445015441.5
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_022_00071.4Aquca_022_00071.3Aquca_022_00071.2Aquca_022_00071.1Aquca_010_00682.1
Aquca_004_00645.1
Arabidopsis lyrata475658485946470561
Arabidopsis thalianaAT1G65590.1AT3G55260.1AT1G05590.1
Brachypodium distachyonBradi2g57420.1Bradi2g25310.1Bradi2g37460.1Bradi3g44607.1Bradi1g69660.1
Bradi1g23740.1
Brassica rapaBra004121Bra014765Bra032460
Carica papayaevm.model.supercontig_197.26
Capsella rubellaCarubv10020116mCarubv10016974mCarubv10011603m
Chlamydomonas reinhardtiig11709.t1
Citrus clementinaCiclev10014808mCiclev10031174mCiclev10031139mCiclev10031669mCiclev10033772m
Ciclev10019509mCiclev10024601m
Citrus sinensisorange1.1g008945morange1.1g013337morange1.1g008821morange1.1g014971morange1.1g044344m
orange1.1g007722morange1.1g007610m
Cucumis sativusCucsa.165600.1Cucsa.178740.1Cucsa.165600.2.144.314Cucsa.165600.2.144.314Cucsa.177460.1
Cucsa.165600.2.312.421Cucsa.165600.2.312.421
Eucalyptus grandisEucgr.G02896.1Eucgr.L01476.1Eucgr.K02799.2Eucgr.K02799.1Eucgr.K02799.3
Eucgr.K02798.2Eucgr.K02798.1
Fragaria vescamrna26730.1-v1.0-hybridmrna02330.1-v1.0-hybrid
Glycine maxGlyma18g52290.1Glyma02g10570.1Glyma20g38400.1Glyma08g17200.1Glyma08g16970.1
Glyma15g41986.1
Gossypium raimondiiGorai.002G136400.2Gorai.002G136400.1Gorai.011G246500.1Gorai.012G068200.1Gorai.012G068200.2
Gorai.002G136400.3Gorai.012G068200.3Gorai.007G264000.1
Linum usitatissimumLus10003292Lus10030323Lus10022251Lus10030348Lus10007899
Malus domesticaMDP0000798095MDP0000262060.270.444MDP0000262060.270.444MDP0000564236MDP0000262060.174.257
MDP0000262060.174.257
Manihot esculentacassava4.1_033827mcassava4.1_033064mcassava4.1_004406mcassava4.1_007813mcassava4.1_023099m
cassava4.1_021615m
Medicago truncatulaMedtr2g062560.1
Mimulus guttatusmgv1a004365mmgv1a003720mmgv1a007861mmgv1a003512mmgv1a023788m
Oryza sativaLOC_Os01g66700.1LOC_Os05g34320.2LOC_Os05g34320.1LOC_Os05g02510.1LOC_Os05g34320.3
LOC_Os07g38790.1LOC_Os03g11980.1
Panicum virgatumPavirv00023753mPavirv00005093mPavirv00062644mPavirv00067910mPavirv00063863m
Pavirv00062646mPavirv00001875mPavirv00056279mPavirv00062645m.258.396Pavirv00062645m.258.396
Pavirv00060770mPavirv00016511mPavirv00054866mPavirv00049460mPavirv00062645m.174.254
Pavirv00062645m.174.254
Physcomitrella patensPp1s70_132V6.1Pp1s3_199V6.1
Phaseolus vulgarisPhvul.008G015400.1Phvul.007G010100.1Phvul.005G045300.1Phvul.005G043200.1
Picea abiesMA_177334g0010MA_271570g0010MA_92690g0010.179.289MA_92690g0010.179.289MA_92690g0010.297.429
MA_92690g0010.297.429
Populus trichocarpaPotri.008G079400.2Potri.008G079400.1Potri.010G211000.2Potri.010G211000.1Potri.010G211000.4
Potri.010G211000.3Potri.008G079400.5Potri.008G079400.3Potri.008G079400.4Potri.001G232800.1
Potri.001G232600.1
Prunus persicappa003880mppa002753m
Ricinus communis29929.m00450328180.m00037729616.m00021628180.m00037634575.m000024
47890.m000013
Setaria italicaSi001028mSi021738mSi024695mSi021693mSi029311m
Si034794m
Selaginella moellendorffii117332429308422139422155445016
422160429325441789422260
Sorghum bicolorSb09g020420.2Sb09g020420.1Sb09g001670.1Sb02g037280.1Sb01g042640.1
Thellungiella halophilaThhalv10018379mThhalv10010264mThhalv10007181mThhalv10007179m
Vitis viniferaGSVIVT01016639001GSVIVT01006264001GSVIVT01004010001GSVIVT01006000001
Volvox carteriVocar20013124m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)