y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma11g06761.1
FamilyPL1
Protein PropertiesLength: 392 Molecular Weight: 43910.5 Isoelectric Point: 9.9159
ChromosomeChromosome/Scaffold: 11 Start: 4778744 End: 4780269
DescriptionPectin lyase-like superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
PL11103100
  VWITFQRDMHIKLERPLLISSFTAIDGRGVNVHIANNACLMIFKATNIIIHGIRVHHCKPQAPGVVMGPEGKVIPLGHVDGDAIRLVTASKIWIDHNTLY
  NCQDGLLDVTRGSTDVTISNNWFRDQDKVMLLGHDDGYVRDQNMKVTVVYNHFGPNCNQRMPRIRHGYAHVANNLYLGWVQYAIGGSMGPSLKSEANLFI
  A
Full Sequence
Protein Sequence     Length: 392     Download
MVSHVINHIL WRFVLIIVII TLYTPNLSAA KQSKINGLKM NVIDRCWRLN PEWRRHRPQL    60
ATCSVGYTGK MTNNIGKDLI HYIVIDPSDD PINPKRGTLR YGASVIQGKV WITFQRDMHI    120
KLERPLLISS FTAIDGRGVN VHIANNACLM IFKATNIIIH GIRVHHCKPQ APGVVMGPEG    180
KVIPLGHVDG DAIRLVTASK IWIDHNTLYN CQDGLLDVTR GSTDVTISNN WFRDQDKVML    240
LGHDDGYVRD QNMKVTVVYN HFGPNCNQRM PRIRHGYAHV ANNLYLGWVQ YAIGGSMGPS    300
LKSEANLFIA PTIGSKEVTW RKSNHNNGDT WEFHSVKDAF ENGASFTVTK GGRVPKPNYS    360
NEQYFKVVDV NFVRSLTRSS GILGCSKTSV C*                                  420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG3866PelB2.0e-26128308193+
pfam00544Pec_lyase_C5.0e-52130308187+
smart00656Amb_all2.0e-62125311196+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI26401.10713911320unnamed protein product [Vitis vinifera]
RefSeqXP_002267384.104039119369PREDICTED: similar to putative Cup s 1 pollen allergen [Vitis vinifera]
RefSeqXP_002299118.10403911354predicted protein [Populus trichocarpa]
RefSeqXP_002304865.10403911352predicted protein [Populus trichocarpa]
RefSeqXP_002527354.101731813307Major pollen allergen Jun v 1 precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1pxz_B0413832345A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen
PDB1pxz_A0413832345A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen
PDB3zsc_A1e-1610431042248A Chain A, Catalytic Function And Substrate Recognition Of The Pectate Lyase From Thermotoga Maritima
PDB1pcl_A0.0000000000000810831561283A Chain A, Unusual Structural Features In The Parallel Beta-Helix In Pectate Lyases
PDB1vbl_A0.0000000000002101308102330A Chain A, Structure Of The Thermostable Pectate Lyase Pl 47
Transmembrane Domains
StartEnd
1330
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DT5757502251623860
DR808308255412880
FD7579992161243390
HO778688356413920
EL457563284413210
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_035_00024.1Aquca_018_00074.1Aquca_015_00229.1
Arabidopsis lyrata487738881338
Arabidopsis thalianaAT5G09280.1AT1G30350.1
Brassica rapaBra009375Bra012756
Carica papayaevm.model.supercontig_42.185evm.model.supercontig_51.17
Capsella rubellaCarubv10002943mCarubv10006459m
Citrus sinensisorange1.1g041616m
Cucumis sativusCucsa.112490.1
Eucalyptus grandisEucgr.K02336.1
Fragaria vescamrna29291.1-v1.0-hybrid
Glycine maxGlyma01g38540.1Glyma16g25710.2Glyma13g21880.2
Gossypium raimondiiGorai.010G196700.1Gorai.010G196900.1Gorai.010G197000.1Gorai.010G197100.1Gorai.010G197400.1
Gorai.008G271800.1Gorai.008G271900.1Gorai.010G197600.1Gorai.010G197500.1Gorai.004G231500.1
Gorai.010G196800.1Gorai.010G197300.1
Linum usitatissimumLus10031867Lus10031296
Malus domesticaMDP0000244018MDP0000233331MDP0000166129
Manihot esculentacassava4.1_026008mcassava4.1_024289mcassava4.1_025601mcassava4.1_023158m
Medicago truncatulaMedtr6g077900.1Medtr8g078350.1Medtr5g035840.1Medtr5g019060.1Medtr4g064420.1
Medtr3g030900.1Medtr8g078310.1Medtr8g078390.1Medtr8g078280.1Medtr5g019090.1
Medtr5g019170.1Medtr5g019160.1
Mimulus guttatusmgv1a021987m
Oryza sativaLOC_Os08g18970.1
Panicum virgatumPavirv00017566m
Physcomitrella patensPp1s385_14V6.1Pp1s45_65V6.1
Phaseolus vulgarisPhvul.004G101900.1Phvul.002G025800.1Phvul.004G098100.1Phvul.004G101600.1
Picea abiesMA_10433764g0010
Populus trichocarpaPotri.003G218200.1Potri.001G007400.1Potri.003G218200.2Potri.005G064500.2Potri.005G064500.1
Prunus persicappa016145mppa021860mppa016917mppa025917mppa016255m
Ricinus communis29596.m00070329743.m000300
Setaria italicaSi013945m
Selaginella moellendorffii88799
Sorghum bicolorSb03g036930.1
Thellungiella halophilaThhalv10015832m
Vitis viniferaGSVIVT01024239001
Zea maysAC233851.1_FGT011
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny