y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma11g09650.2
FamilyGT77
Protein PropertiesLength: 628 Molecular Weight: 71921.6 Isoelectric Point: 6.2397
ChromosomeChromosome/Scaffold: 11 Start: 6874919 End: 6882521
Descriptionxyloglucanase 113
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT771423660
  VSNYLVGAMDIKLLEALYWKGIPVFDMGSHMSTDDVGWGSPTFHKMGREKVLLINLILPFGYELLMCDTDMVWLKNPLPYLARYPEADVLTSSDQVVPTV
  VDDSLEIWQEVGAAYNIGIFHWRPTESAKKLAKEWKELLLADDKIWDQNGFNDIVHRQLGPSVDEDSGLVYAYDGNLKLGILPSSIFCSGHTYFVQAMYQ
  QLRLEPYAVHTTFQYAGTEGKRHRL
Full Sequence
Protein Sequence     Length: 628     Download
MACEEVAHSR PLFLTIYTIV IVGIVFSSLY VFSAIRHPSA IPSTWSLSNE DVRLTEQTLN    60
GSQSETVHIV PSVPQEARKM RTRPILSVPP RNKKMPSLNA FRLTKELVQQ RVKDNIIILT    120
FGNYAFMDFI LTWVEQLNDL GVSNYLVGAM DIKLLEALYW KGIPVFDMGS HMSTDDVGWG    180
SPTFHKMGRE KVLLINLILP FGYELLMCDT DMVWLKNPLP YLARYPEADV LTSSDQVVPT    240
VVDDSLEIWQ EVGAAYNIGI FHWRPTESAK KLAKEWKELL LADDKIWDQN GFNDIVHRQL    300
GPSVDEDSGL VYAYDGNLKL GILPSSIFCS GHTYFVQAMY QQLRLEPYAV HTTFQYAGTE    360
GKRHRLREAM VFRDPPEYYN PPGGFLSFKP SIPKSLLLSG NHTIESHFRL VNYQIKQIRT    420
ALAIASLLNR TLVMPPLWCR IDRLWFPHPG VLDGSITRQP FLCPLDHVFE VNVMLKELPE    480
EEFGSGVDIR EYSILDNPSL PSEVKMSWLD VQLCKDGTQD CFASNNTTVG GVLKFPRHSN    540
EETYMKVFLS FKDIKVIQFS SMQDAFSGFS DKEREDRFRK RVKRYTGIWC CVLDHTPGHI    600
YYDMYWDEKP EWKPIPPQTS ADDHPPW*                                       660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03407Nucleotid_trans2.0e-41142366231+
Gene Ontology
GO TermDescription
GO:0005783endoplasmic reticulum
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI29197.107862794642unnamed protein product [Vitis vinifera]
RefSeqNP_850250.107562692643unknown protein [Arabidopsis thaliana]
RefSeqXP_002269181.1078627163711PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002328759.107862789638predicted protein [Populus trichocarpa]
RefSeqXP_002519934.1026277639reticulon3-A3, putative [Ricinus communis]
Transmembrane Domains
StartEnd
1335
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DT5119933041164190
EV2351133101724810
EX1308722951854790
GR7084012981284250
GR85791624032420
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_011_00317.5Aquca_011_00317.4Aquca_011_00317.3Aquca_011_00317.2Aquca_011_00317.1
Arabidopsis lyrata902666
Arabidopsis thalianaAT2G35610.1
Brachypodium distachyonBradi1g15410.1Bradi3g45950.1
Brassica rapaBra017310Bra005325
Carica papayaevm.model.supercontig_90.39
Capsella rubellaCarubv10022808m
Chlamydomonas reinhardtiig13982.t1g15149.t1Cre02.g082950.t1.3Cre01.g000400.t1.2Cre01.g000450.t1.2
g4580.t1Cre07.g340950.t1.3Cre04.g224350.t1.3Cre01.g000500.t1.3Cre09.g416650.t1.2
Cre13.g574100.t1.2Cre13.g574041.t1.1Cre13.g574050.t1.2Cre07.g332500.t1.2
Citrus clementinaCiclev10011269m
Citrus sinensisorange1.1g036925m
Cucumis sativusCucsa.018320.1Cucsa.018320.10Cucsa.018320.3
Eucalyptus grandisEucgr.E01147.2Eucgr.E01147.1
Fragaria vescamrna10921.1-v1.0-hybrid
Glycine maxGlyma01g35690.1Glyma16g08350.1Glyma16g20730.1Glyma16g08350.3Glyma16g08350.2
Gossypium raimondiiGorai.004G177500.4Gorai.008G219000.2Gorai.004G177500.5Gorai.004G177500.6Gorai.004G177500.7
Gorai.004G177500.9Gorai.004G177500.2Gorai.004G177500.3Gorai.004G177500.1Gorai.008G219000.1
Gorai.004G177500.8
Linum usitatissimumLus10005034Lus10027804
Malus domesticaMDP0000349223
Manihot esculentacassava4.1_003398mcassava4.1_008884m
Medicago truncatulaMedtr8g072310.1Medtr5g025590.1
Mimulus guttatusmgv1a002766m
Oryza sativaLOC_Os03g38930.1
Panicum virgatumPavirv00057126mPavirv00045617mPavirv00069114m
Physcomitrella patensPp1s46_165V6.1
Phaseolus vulgarisPhvul.003G278500.1Phvul.002G122000.1
Picea abiesMA_486176g0010MA_10433213g0010
Populus trichocarpaPotri.004G235800.1Potri.004G235800.2
Prunus persicappa002815m
Ricinus communis29827.m002651
Setaria italicaSi034728m
Selaginella moellendorffii127789
Sorghum bicolorSb01g015590.1
Thellungiella halophilaThhalv10016368m
Vitis viniferaGSVIVT01036881001
Volvox carteriVocar20007251mVocar20009385mVocar20010418mVocar20002020mVocar20004159m
Vocar20001219mVocar20001335mVocar20001723mVocar20006862mVocar20009663m
Vocar20008350mVocar20001348m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)