y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma11g10061.1
FamilyGH17
Protein PropertiesLength: 222 Molecular Weight: 24685.8 Isoelectric Point: 5.8594
ChromosomeChromosome/Scaffold: 11 Start: 7192264 End: 7193513
DescriptionGlycosyl hydrolase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1717941.7e-23
  KEVVDLYKTNGIGRMRIYYEKALQALRGSGIELIMDVAKDTLQSLTNANAARDWVNKYVTPYSRDVNFKYIVVGNEIG
GH17992190
  EVALFNQQGIDNAGYQNLFDAMLDSIYAAVEKVGAPNLKIVVSESGWPSEGGDGASIENARTYYSNLIDHVSSGNGTPKRRGPIETYLFAMFDENQKSGK
  ETERHFGLYRPDKSSKYQLRF
Full Sequence
Protein Sequence     Length: 222     Download
MSAILLLVEI LSYITGKEVV DLYKTNGIGR MRIYYEKALQ ALRGSGIELI MDVAKDTLQS    60
LTNANAARDW VNKYVTPYSR DVNFKYIVVG NEIGPNTNEV ALFNQQGIDN AGYQNLFDAM    120
LDSIYAAVEK VGAPNLKIVV SESGWPSEGG DGASIENART YYSNLIDHVS SGNGTPKRRG    180
PIETYLFAMF DENQKSGKET ERHFGLYRPD KSSKYQLRFN N*                       240
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG5309COG53090.00213821180+
pfam00332Glyco_hydro_176.0e-221810288+
pfam00332Glyco_hydro_175.0e-59101219123+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAR26001.1099220220340endo-1,3-beta-glucanase [Glycine max]
GenBankACU20860.11e-24159546128unknown [Glycine max]
GenBankACU20860.10101220222340unknown [Glycine max]
DDBJBAE53384.11e-23159546127beta-1,3-glucanase [Sesbania rostrata]
DDBJBAE53384.1099220219339beta-1,3-glucanase [Sesbania rostrata]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3ur8_B096220186315A Chain A, Arabidopsis Thaliana Peroxidase A2
PDB3ur8_B2e-161514516136A Chain A, Arabidopsis Thaliana Peroxidase A2
PDB3ur8_A096220186315A Chain A, Arabidopsis Thaliana Peroxidase A2
PDB3ur8_A2e-161514516136A Chain A, Arabidopsis Thaliana Peroxidase A2
PDB3ur7_B096220186315A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase
Signal Peptide
Cleavage Site
16
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FF395955249242200
FF396658240242110
EH2238331211012200
EH2234551211012200
EH2229141211012200
Orthologous Group
SpeciesID
Arabidopsis lyrata326432.33.170326432.33.170910092
Brassica rapaBra014643Bra014639
Carica papayaevm.model.supercontig_49.128.28.175evm.model.supercontig_49.128.28.175evm.model.supercontig_49.126
Citrus sinensisorange1.1g038030morange1.1g046781morange1.1g046740m
Fragaria vescamrna21954.1-v1.0-hybrid.12.119mrna21954.1-v1.0-hybrid.12.119mrna05671.1-v1.0-hybrid.102.226mrna05671.1-v1.0-hybrid.102.226
Glycine maxGlyma11g10061.1.17.94Glyma11g10061.1.17.94Glyma03g28841.1
Gossypium raimondiiGorai.008G159300.2.29.126Gorai.008G159300.2.29.126Gorai.010G003400.1.49.154Gorai.010G003400.1.49.154
Malus domesticaMDP0000609149.30.144MDP0000247130.167.242MDP0000247130.167.242MDP0000577118MDP0000275579
MDP0000281216MDP0000609149.30.144
Manihot esculentacassava4.1_023209m
Medicago truncatulaMedtr2g034440.2.22.152Medtr2g034440.2.22.152
Panicum virgatumPavirv00034981m
Picea abiesMA_1006327g0010MA_837697g0010MA_6944718g0010MA_10383303g0010MA_219456g0010.27.188
MA_9530584g0020MA_688105g0010MA_219456g0010.27.188MA_100289g0010MA_10429961g0010
MA_10435462g0010MA_4654636g0010MA_207447g0010MA_10309446g0010
Populus trichocarpaPotri.016G042800.1
Prunus persicappa022480m
Ricinus communis30147.m013731.287.42730147.m013731.287.427
Thellungiella halophilaThhalv10015274m
Vitis viniferaGSVIVT01031544001.30.128GSVIVT01031543001.30.126GSVIVT01031543001.30.126GSVIVT01033543001GSVIVT01033540001
GSVIVT01031542001.43.122GSVIVT01031542001.43.122GSVIVT01031544001.30.128
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny