y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma11g10760.1
FamilyCBM49
Protein PropertiesLength: 628 Molecular Weight: 69202.7 Isoelectric Point: 6.199
ChromosomeChromosome/Scaffold: 11 Start: 7642018 End: 7646694
Descriptionglycosyl hydrolase 9C1
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM495356148.9e-30
  VEFLHSISSSWTVGGATYYHHRVIIKNTSSKPISDLKLVIKDLSGSLWGLSPTEEKDTYELPQWNKVLNPGSECIFVYVQ
GH9274880
  NYGDALDKSLMFFEAQRSGKLPLQQRVKWRGDSGLQDGFQQRVDLVGGYYDAGDHVKFGLPMAYSVTMLAWGAIEFNKEITDLNQMGHALWAIKWGTDYF
  IKAHTQPNVLWGQVGDGVSDHYCWERAEDMTTSRGAYKIDEQHPGSDLAGETAAALAAAAIAFRPYNSSYSNLLLVHAKQLFTFADRFRGLYDNSISSAQ
  QFYTSSGYSDELLWAATWLHLATGNEYYIKYVVDNAVYMGGTGWAVKEFSWDNKYAGVQILLSKVLLEGKAGAYSATLKQYQAKAEYFTCACLQKNDDYN
  VQKTPGGLLYVREWNNMQYVSSAAFLLAVYSNYLSATKSQLNCPDGQTQPQELLNFVKSQADYILGKNPADVSYLVGYGAKYPLHVHHRGASIASVFALH
  YDVGCTQGFEMWYNRAEPNPNVICGGLVGGPDKNDDFSDERSNYEQTEPTISGSAPLVGIFA
Full Sequence
Protein Sequence     Length: 628     Download
MNLNISLCML LIALVLRLGG SAPSGFNYGD ALDKSLMFFE AQRSGKLPLQ QRVKWRGDSG    60
LQDGFQQRVD LVGGYYDAGD HVKFGLPMAY SVTMLAWGAI EFNKEITDLN QMGHALWAIK    120
WGTDYFIKAH TQPNVLWGQV GDGVSDHYCW ERAEDMTTSR GAYKIDEQHP GSDLAGETAA    180
ALAAAAIAFR PYNSSYSNLL LVHAKQLFTF ADRFRGLYDN SISSAQQFYT SSGYSDELLW    240
AATWLHLATG NEYYIKYVVD NAVYMGGTGW AVKEFSWDNK YAGVQILLSK VLLEGKAGAY    300
SATLKQYQAK AEYFTCACLQ KNDDYNVQKT PGGLLYVREW NNMQYVSSAA FLLAVYSNYL    360
SATKSQLNCP DGQTQPQELL NFVKSQADYI LGKNPADVSY LVGYGAKYPL HVHHRGASIA    420
SVFALHYDVG CTQGFEMWYN RAEPNPNVIC GGLVGGPDKN DDFSDERSNY EQTEPTISGS    480
APLVGIFAKL QSLYGNIGEG YNHNESPVPQ QKTPSTNPGK TTMSKTSSES EGAPVEFLHS    540
ISSSWTVGGA TYYHHRVIIK NTSSKPISDL KLVIKDLSGS LWGLSPTEEK DTYELPQWNK    600
VLNPGSECIF VYVQGGPQAT VSIKSLH*                                       660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02340PLN0234003627625+
PLN02171PLN0217105625622+
PLN02420PLN02420013508498+
PLN00119PLN0011903490488+
pfam00759Glyco_hydro_9027488464+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005576extracellular region
GO:0005975carbohydrate metabolic process
GO:0030246carbohydrate binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI27137.1016271615unnamed protein product [Vitis vinifera]
RefSeqNP_175323.102662529625AtGH9C1 (Arabidopsis thaliana glycosyl hydrolase 9C1); catalytic/ hydrolase, hydrolyzing O-glycosyl compounds
RefSeqXP_002277177.10326271575PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002310080.102562525609glycosyl hydrolase family 9 [Populus trichocarpa]
RefSeqXP_002527135.1026273620endo-1,4-beta-glucanase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ksd_A0264933431A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB1ksc_A0264933431A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB1ks8_A0264933431A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB2xfg_A02249720466B Chain B, Reassembly And Co-Crystallization Of A Family 9 Processive Endoglucanase From Separately Expressed Gh9 And Cbm3c Modules
PDB4tf4_B0264954445B Chain B, Reassembly And Co-Crystallization Of A Family 9 Processive Endoglucanase From Separately Expressed Gh9 And Cbm3c Modules
Signal Peptide
Cleavage Site
21
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CF9215552512675170
HO783495377314060
DY9681622871734590
DY287831341263650
DY27436539513910
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01464.1.518.596Aquca_037_00141.1.542.619Aquca_013_00114.1.534.611
Arabidopsis lyrata474038.535.614489943.534.611892975.528.605
Arabidopsis thalianaAT1G64390.1.528.605AT1G48930.1.535.614AT4G11050.1.534.611
Brachypodium distachyonBradi2g32270.1.538.616Bradi2g07150.1.534.613
Brassica rapaBra032270.517.596Bra000732.268.345Bra027699.529.606Bra018765.532.611Bra027735.528.605
Carica papayaevm.model.supercontig_183.4.367.446evm.TU.contig_27379.2.529.606
Capsella rubellaCarubv10012624m.534.613Carubv10003874m.535.612Carubv10019981m.528.605
Citrus clementinaCiclev10019301m.537.614Ciclev10033912m.569.648
Citrus sinensisorange1.1g043219m.499.578orange1.1g019436m.249.326orange1.1g017562m.277.354orange1.1g011712m.387.464orange1.1g006835m.537.614
Cucumis sativusCucsa.107370.1.527.604Cucsa.128330.1.503.582Cucsa.303850.1.533.608
Eucalyptus grandisEucgr.D01733.1.529.606Eucgr.J00862.1.484.562Eucgr.E00858.1.526.602Eucgr.D01896.1
Fragaria vescamrna32087.1-v1.0-hybrid.632.709mrna11058.1-v1.0-hybrid.533.612
Glycine maxGlyma12g03050.1.537.616Glyma05g36930.1.532.609Glyma08g02610.1.533.610Glyma11g10760.1.535.614
Gossypium raimondiiGorai.003G080800.1.533.609Gorai.008G254000.1.534.611Gorai.004G133700.1.536.613Gorai.005G210200.1.530.608
Linum usitatissimumLus10003888.529.606Lus10010201.535.613Lus10032377.534.611Lus10017402.508.586Lus10001833.527.603
Lus10033956
Malus domesticaMDP0000276676.536.613MDP0000131267.528.605MDP0000548943MDP0000722052.313.390MDP0000826600.538.616
Manihot esculentacassava4.1_004404m.486.565cassava4.1_003698m.530.607
Medicago truncatulaMedtr4g074960.1.571.649
Mimulus guttatusmgv1a003302m.501.580
Oryza sativaLOC_Os01g12070.1.544.625LOC_Os01g12030.1.543.620LOC_Os04g57860.1.531.610LOC_Os05g12150.1.535.613
Panicum virgatumPavirv00000152m.548.625Pavirv00066185m.348.426Pavirv00000772m.535.612Pavirv00030375m.537.614Pavirv00029375m.528.607
Physcomitrella patensPp1s176_127V6.1.544.623
Phaseolus vulgarisPhvul.011G030300.1.567.645Phvul.002G297600.1.530.607
Picea abiesMA_895058g0010MA_10437098g0010.516.596MA_127108g0010.524.603MA_42717g0010.527.604MA_10241783g0010.543.621
MA_19509g0020.547.626
Populus trichocarpaPotri.003G139600.1.530.607Potri.001G092200.1.530.607Potri.001G092200.5.285.362Potri.007G071200.1.520.599Potri.007G071200.2.519.598
Potri.001G092200.4.375.452
Prunus persicappa002939m.528.605ppa022524m.499.578
Ricinus communis29675.m000388.528.607
Setaria italicaSi000642m.549.626Si021474m.530.607Si021476m.528.606
Selaginella moellendorffii234652.525.60399802.550.630
Sorghum bicolorSb09g006670.1.535.612Sb03g001560.1.561.639Sb06g032760.1.534.615
Thellungiella halophilaThhalv10023353m.527.604Thhalv10011318m.534.613Thhalv10028514m.535.612
Vitis viniferaGSVIVT01019523001.537.614GSVIVT01012043001.524.602
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)