y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma11g11200.1
FamilyCBM22
Protein PropertiesLength: 567 Molecular Weight: 64480.8 Isoelectric Point: 6.171
ChromosomeChromosome/Scaffold: 11 Start: 7966942 End: 7970370
DescriptionGlycosyl hydrolase family 10 protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM22731881.5e-22
  IIQNPELNNGLQGWTAFGDARIEHRESLGNKYVVAHRRNQAHDSVSQKIYLQKDKHYTLSAWIQVSEGNVPVTAIVKTTTRLKFAGAIFAESNCWSMLKG
  GFTADESGPAELYFEG
GH102224930
  HNSYILNNGLYKNWFTSRFTVTTFENEMKWYSTENVQGREDYSVADAMLQFVKQHNIAVRGHNIFWDDPRYQPGWVPSLSPYQLNSAVEKRVRSVVSRYR
  GQLISWDVVNENLHFSFFEGKLGQAFSGRIFHEAHNIDGQTTLFLNEYNTIEDSRDGVSIPARYIQKLKKIQSYPGNAGLPIGIGLEAHFSGPGINFPYL
  RASIDYLAATRLPIWITELDVASQPRQYFELALRELHGHPMVRGIVMWTAWSPQGCYRICLVDNNFRNLPAG
Full Sequence
Protein Sequence     Length: 567     Download
MVMVFGWKVA TLVRDGGGLV GGAVVMVNVL EEELIYLSFV TTTGFEAEAL SYDYSASIEC    60
LAHPQNPLYN GGIIQNPELN NGLQGWTAFG DARIEHRESL GNKYVVAHRR NQAHDSVSQK    120
IYLQKDKHYT LSAWIQVSEG NVPVTAIVKT TTRLKFAGAI FAESNCWSML KGGFTADESG    180
PAELYFEGNN TSVEIWIDNV ALQPFTEGEW RSHQDESIEK CHNSYILNNG LYKNWFTSRF    240
TVTTFENEMK WYSTENVQGR EDYSVADAML QFVKQHNIAV RGHNIFWDDP RYQPGWVPSL    300
SPYQLNSAVE KRVRSVVSRY RGQLISWDVV NENLHFSFFE GKLGQAFSGR IFHEAHNIDG    360
QTTLFLNEYN TIEDSRDGVS IPARYIQKLK KIQSYPGNAG LPIGIGLEAH FSGPGINFPY    420
LRASIDYLAA TRLPIWITEL DVASQPRQYF ELALRELHGH PMVRGIVMWT AWSPQGCYRI    480
CLVDNNFRNL PAGNVVDRLL SEWRLSKLSG MTDQNGFFEA NLFHGDYEME ISHPVMKNYT    540
FTQRLQVTPI EEYFKETKQF VQLSMK*                                        600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam02018CBM_4_98.0e-680192123+
COG3693XynA3.0e-35240492292+
pfam00331Glyco_hydro_108.0e-52222496305+
smart00633Glyco_102.0e-70249496273+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
GO:0016798hydrolase activity, acting on glycosyl bonds
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAN10199.104453424553endoxylanase [Carica papaya]
RefSeqXP_002264556.103356491657PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002264605.104356418573PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002313180.10595332512predicted protein [Populus trichocarpa]
RefSeqXP_002532418.104455215559Endo-1,4-beta-xylanase C precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ta3_B4e-2722150120303B Chain B, Crystal Structure Of Xylanase (Gh10) In Complex With Inhibitor (Xip)
PDB1tux_A9e-2423850038301A Chain A, High Resolution Crystal Structure Of A Thermostable Xylanase From Thermoascus Aurantiacus
PDB1nq6_A2e-2322749624298A Chain A, Crystal Structure Of The Catalytic Domain Of Xylanase A From Streptomyces Halstedii Jm8
PDB2bnj_A3e-2323850238303A Chain A, The Xylanase Ta From Thermoascus Aurantiacus Utilizes Arabinose Decorations Of Xylan As Significant Substrate Specificity Determinants
PDB1k6a_A6e-2323850238303A Chain A, Structural Studies On The Mobility In The Active Site Of The Thermoascus Aurantiacus Xylanase I
Metabolic Pathways
Pathway NameReactionECProtein Name
(1,4)-β-xylan degradation3.2.1.8-RXNEC-3.2.1.8endo-1,4-β-xylanase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EX2661282742325030
BI3120302453235650
BI3103942313375650
CF0687592203305470
EX266128295085340.068
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_011_00218.1.27.143Aquca_011_00219.1.49.165
Arabidopsis lyrata913024.46.162491295.46.161
Arabidopsis thalianaAT4G33840.1.46.161AT4G33830.1.47.162AT4G33860.1.46.161
Brachypodium distachyonBradi1g71040.1.54.172
Brassica rapaBra034585.47.155Bra034584.46.161Bra017609.141.256
Carica papayaevm.model.supercontig_106.45.53.168
Capsella rubellaCarubv10006586m.46.161
Citrus clementinaCiclev10030382m.52.167
Fragaria vescamrna28152.1-v1.0-hybrid.50.168
Glycine maxGlyma11g11200.1.73.188Glyma11g11220.1.35.152
Linum usitatissimumLus10020985.24.142Lus10033786.35.153Lus10014642.40.158
Malus domesticaMDP0000245498.55.170
Manihot esculentacassava4.1_021918m.41.156
Mimulus guttatusmgv1a003597m.49.165
Oryza sativaLOC_Os03g10478.1.55.172LOC_Os03g10440.1.51.167
Panicum virgatumPavirv00027101m.14.130Pavirv00026745m.37.153
Phaseolus vulgarisPhvul.011G033100.1.41.156
Picea abiesMA_429144g0010.58.183MA_10434167g0010MA_7941351g0010
Populus trichocarpaPotri.009G087900.1.27.142
Prunus persicappa021363m.43.158
Ricinus communis29812.m000195.44.159
Setaria italicaSi034867m.54.170Si034912m.47.163
Selaginella moellendorffii420481.76.197
Thellungiella halophilaThhalv10024995m.45.160Thhalv10027468m.47.162
Vitis viniferaGSVIVT01037833001.70.185GSVIVT01037825001.23.138
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny