y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma11g11220.1
FamilyCBM22
Protein PropertiesLength: 567 Molecular Weight: 64021.9 Isoelectric Point: 6.0101
ChromosomeChromosome/Scaffold: 11 Start: 7975139 End: 7977850
DescriptionGlycosyl hydrolase family 10 protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM22351526.2e-22
  IIQNPELNNELQGWTAFGDAKIEHRESLGNKYAVVHSRNQARDSVSQKIYLQKDKHYTLSAWIQVKGSEGNVPVTAVVKTTTRLKFAGAIFAESNCWSML
  KGGLTSDESGPAELYFEG
GH102114720
  QKRPGFPFGSSMSSSILNNKLYQDWFTSRFTVTTFGNEMKWYSTENVQGKEDYSVADAMLQFAKQHNIAVRGHNIFWDDPHFQPSWVPSLSPPQLNSAVE
  KRVRSVVSRYRGQLIAWDVVNENLHFSFFEDKLGQAFSGRIFNEAHNIDGQTTLFLNEYNTIEDSRDGVSSPAKYIQKLKQIQSYPGNAGLPIGIGLEAH
  FPAQGINFPYLRASIDNLAATRLPIWITELDVASQPKQSQYFELALRELHGHPMVRGLVMWT
Full Sequence
Protein Sequence     Length: 567     Download
MLLTTGFEVE ALSYDYSASI ECLAHPLKPL YNGGIIQNPE LNNELQGWTA FGDAKIEHRE    60
SLGNKYAVVH SRNQARDSVS QKIYLQKDKH YTLSAWIQVK GSEGNVPVTA VVKTTTRLKF    120
AGAIFAESNC WSMLKGGLTS DESGPAELYF EGNDTSAEIW IDNVSLQPFT EEEWRSHQDE    180
SIERARKRKV LVQAVDEEGN PLPNATISFV QKRPGFPFGS SMSSSILNNK LYQDWFTSRF    240
TVTTFGNEMK WYSTENVQGK EDYSVADAML QFAKQHNIAV RGHNIFWDDP HFQPSWVPSL    300
SPPQLNSAVE KRVRSVVSRY RGQLIAWDVV NENLHFSFFE DKLGQAFSGR IFNEAHNIDG    360
QTTLFLNEYN TIEDSRDGVS SPAKYIQKLK QIQSYPGNAG LPIGIGLEAH FPAQGINFPY    420
LRASIDNLAA TRLPIWITEL DVASQPKQSQ YFELALRELH GHPMVRGLVM WTGPSPEGCY    480
RICLVDNNFR NLPAGKVVDK LLSEWRLSKL SGMTDQNGFF EANLFHGDYE IEVSHPVMKN    540
YTFTQRLQVT PTDDSKETKQ FVQLSM*                                        600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam02018CBM_4_92.0e-545156122+
COG3693XynA6.0e-34240442216+
pfam00331Glyco_hydro_104.0e-54216471277+
smart00633Glyco_108.0e-74249498273+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
GO:0016798hydrolase activity, acting on glycosyl bonds
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAN10199.10255920578endoxylanase [Carica papaya]
RefSeqXP_002264556.1010565108657PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002264652.10655523570PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002313180.10205351512predicted protein [Populus trichocarpa]
RefSeqXP_002532418.10656315568Endo-1,4-beta-xylanase C precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ta3_B1e-2821850317303B Chain B, Crystal Structure Of Xylanase (Gh10) In Complex With Inhibitor (Xip)
PDB1tux_A8e-262095029301A Chain A, High Resolution Crystal Structure Of A Thermostable Xylanase From Thermoascus Aurantiacus
PDB1nq6_A2e-2521849815298A Chain A, Crystal Structure Of The Catalytic Domain Of Xylanase A From Streptomyces Halstedii Jm8
PDB1gor_A4e-222094949293A Chain A, Crystal Structure Of The Catalytic Domain Of Xylanase A From Streptomyces Halstedii Jm8
PDB1goq_A4e-222094949293A Chain A, Crystal Structure Of The Catalytic Domain Of Xylanase A From Streptomyces Halstedii Jm8
Metabolic Pathways
Pathway NameReactionECProtein Name
(1,4)-β-xylan degradation3.2.1.8-RXNEC-3.2.1.8endo-1,4-β-xylanase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EX2661282742325050
BI3120302453235670
BI3103942313375670
BI31024721612160
EX266128295105360.022
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_011_00218.1.27.143Aquca_011_00219.1.49.165
Arabidopsis lyrata913024.46.162491295.46.161
Arabidopsis thalianaAT4G33840.1.46.161AT4G33830.1.47.162AT4G33860.1.46.161
Brachypodium distachyonBradi1g71040.1.54.172
Brassica rapaBra034585.47.155Bra034584.46.161Bra017609.141.256
Carica papayaevm.model.supercontig_106.45.53.168
Capsella rubellaCarubv10006586m.46.161
Citrus clementinaCiclev10030382m.52.167
Fragaria vescamrna28152.1-v1.0-hybrid.50.168
Glycine maxGlyma11g11200.1.73.188Glyma11g11220.1.35.152
Linum usitatissimumLus10020985.24.142Lus10033786.35.153Lus10014642.40.158
Malus domesticaMDP0000245498.55.170
Manihot esculentacassava4.1_021918m.41.156
Mimulus guttatusmgv1a003597m.49.165
Oryza sativaLOC_Os03g10478.1.55.172LOC_Os03g10440.1.51.167
Panicum virgatumPavirv00027101m.14.130Pavirv00026745m.37.153
Phaseolus vulgarisPhvul.011G033100.1.41.156
Picea abiesMA_429144g0010.58.183MA_10434167g0010MA_7941351g0010
Populus trichocarpaPotri.009G087900.1.27.142
Prunus persicappa021363m.43.158
Ricinus communis29812.m000195.44.159
Setaria italicaSi034867m.54.170Si034912m.47.163
Selaginella moellendorffii420481.76.197
Thellungiella halophilaThhalv10024995m.45.160Thhalv10027468m.47.162
Vitis viniferaGSVIVT01037833001.70.185GSVIVT01037825001.23.138
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny