y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma11g13766.2
FamilyGH1
Protein PropertiesLength: 130 Molecular Weight: 14975.1 Isoelectric Point: 10.1002
ChromosomeChromosome/Scaffold: 11 Start: 9794153 End: 9794936
Descriptionbeta glucosidase 17
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH111162e-26
  MEPLTKGEYPRNMRALVGSRLPKFSKWQAKLVNGSFDFIGLNYYSSGYINGVPPSNAKPSFLTDSRTNTTFERNGRPLGLRAASNWIYFYPKGLRDLLLY
  TKDKYNNPLIYITENG
Full Sequence
Protein Sequence     Length: 130     Download
MEPLTKGEYP RNMRALVGSR LPKFSKWQAK LVNGSFDFIG LNYYSSGYIN GVPPSNAKPS    60
FLTDSRTNTT FERNGRPLGL RAASNWIYFY PKGLRDLLLY TKDKYNNPLI YITENGKYAL    120
IHYVYFYFT*                                                           180
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02849PLN028492.0e-151117120+
PLN02998PLN029981.0e-151117117+
TIGR03356BGL8.0e-161116119+
PLN02814PLN028141.0e-161117121+
pfam00232Glyco_hydro_16.0e-271116118+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABI34907.301116186302glycoside hydrolase family 1 protein [Leucaena leucocephala]
GenBankABY48758.101116299415glycosylhydrolase 1 [Leucaena leucocephala]
GenBankABY84677.12.8026e-451116202318coniferrin beta glucosidase [Leucaena leucocephala]
GenBankACD65511.101116308424beta-glucosidase D7 [Lotus japonicus]
DDBJBAF34333.101116307422isoflavone conjugate-specific beta-glucosidase [Glycine max]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3ptq_B3.00018e-421116298414A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12
PDB3ptq_A3.00018e-421116298414A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12
PDB3ptm_B3.00018e-421116298414A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12
PDB3ptm_A3.00018e-421116298414A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12
PDB3ptk_B3.00018e-421116298414A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12
Metabolic Pathways
Pathway NameReactionECProtein Name
coumarin biosynthesis (via 2-coumarate)RXN-8036EC-3.2.1.21β-glucosidase
linamarin degradationRXN-5341EC-3.2.1.21β-glucosidase
linustatin bioactivationRXN-13602EC-3.2.1.21β-glucosidase
linustatin bioactivationRXN-5341EC-3.2.1.21β-glucosidase
lotaustralin degradationRXN-9674EC-3.2.1.21β-glucosidase
neolinustatin bioactivationRXN-13603EC-3.2.1.21β-glucosidase
neolinustatin bioactivationRXN-9674EC-3.2.1.21β-glucosidase
taxiphyllin bioactivationRXN-13600EC-3.2.1.21β-glucosidase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
BE02062011611160
AW10144011611160
AI73644411611160
BQ45349711611160
CX71104211611160
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_346_00002.1
Eucalyptus grandisEucgr.K00923.1
Fragaria vescamrna26801.1-v1.0-hybrid
Glycine maxGlyma08g15960.5Glyma08g15993.1Glyma08g15960.4Glyma08g15950.2
Gossypium raimondiiGorai.008G271500.8.159.363Gorai.008G271500.8.159.363
Linum usitatissimumLus10011828.473.717Lus10000225Lus10011828.473.717
Malus domesticaMDP0000285510MDP0000295323MDP0000187265
Medicago truncatulaMedtr4g015460.2
Mimulus guttatusmgv1a025884mmgv1a014264m
Oryza sativaLOC_Os04g39814.3
Panicum virgatumPavirv00040514mPavirv00034317mPavirv00068709m
Phaseolus vulgarisPhvul.011G055700.2
Picea abiesMA_173229g0010
Populus trichocarpaPotri.T019200.1.296.514Potri.T177800.2Potri.T019200.1.296.514Potri.T177800.1Potri.T177800.3
Prunus persicappa026358mppa015721m
Vitis viniferaGSVIVT01032017001GSVIVT01032006001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny