y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma11g13856.1
FamilyGH1
Protein PropertiesLength: 162 Molecular Weight: 18826.3 Isoelectric Point: 8.3899
ChromosomeChromosome/Scaffold: 11 Start: 9864728 End: 9867215
Descriptionbeta glucosidase 14
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1211570
  NTQKKIKEGSNGEVADDSYHRYKEDIGIMKYMNLDAYRFSISWSKILPRKLSAGVNHEGVNYYNNLINELMANGLQPYVQSYVTFFHWDVPQALEDEDDF
  RDSAEFCLKEFDNRVKHWITLNEPRSASKNGYANGRH
Full Sequence
Protein Sequence     Length: 162     Download
MKVLQVKVEK DRVYGILSLI NTQKKIKEGS NGEVADDSYH RYKEDIGIMK YMNLDAYRFS    60
ISWSKILPRK LSAGVNHEGV NYYNNLINEL MANGLQPYVQ SYVTFFHWDV PQALEDEDDF    120
RDSAEFCLKE FDNRVKHWIT LNEPRSASKN GYANGRHLKR V*                       180
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02814PLN028148.0e-3318143136+
PLN02998PLN029982.0e-3532155134+
COG2723BglB5.0e-4220157148+
TIGR03356BGL5.0e-4921157146+
pfam00232Glyco_hydro_15.0e-5221157146+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABK60303.202415773213glycosylhydrolase family 1 [Leucaena leucocephala]
GenBankABV54752.102415560198cyanogenic beta-glucosidase [Trifolium nigrescens subsp. petrisavii]
GenBankABV54754.102415660199beta-glucosidase-like protein [Trifolium repens]
EMBLCBI16441.102155110268unnamed protein product [Vitis vinifera]
Swiss-ProtP2620502415568206BGLT_TRIRP RecName: Full=Cyanogenic beta-glucosidase; AltName: Full=Linamarase; Flags: Precursor
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1cbg_A02415557195A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase
PDB4atl_B02615562198A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase
PDB4atl_A02615562198A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase
PDB4atd_B02615562198A Chain A, Crystal Structure Of Native Raucaffricine Glucosidase
PDB4atd_A02615562198A Chain A, Crystal Structure Of Native Raucaffricine Glucosidase
Metabolic Pathways
Pathway NameReactionECProtein Name
coumarin biosynthesis (via 2-coumarate)RXN-8036EC-3.2.1.21β-glucosidase
linamarin degradationRXN-5341EC-3.2.1.21β-glucosidase
linustatin bioactivationRXN-13602EC-3.2.1.21β-glucosidase
linustatin bioactivationRXN-5341EC-3.2.1.21β-glucosidase
lotaustralin degradationRXN-9674EC-3.2.1.21β-glucosidase
neolinustatin bioactivationRXN-13603EC-3.2.1.21β-glucosidase
neolinustatin bioactivationRXN-9674EC-3.2.1.21β-glucosidase
taxiphyllin bioactivationRXN-13600EC-3.2.1.21β-glucosidase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FE710071144241560
AW26780816611550
BM892120131241430
BM892120251250.00004
FE710071271270.018