y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma11g18350.1
FamilyGH5
Protein PropertiesLength: 545 Molecular Weight: 60849 Isoelectric Point: 7.1139
ChromosomeChromosome/Scaffold: 11 Start: 15033245 End: 15037204
DescriptionCellulase (glycosyl hydrolase family 5) protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH5393532.40042e-42
  IVDESGKRVKLACVNWVSHLDAVVAEGLSQQPLDEISKRIKTMGFNCVRLTWPLFLVTNDSIASLTLRNSFQNLGLIQSLNGVQAINPSIIDLPLIKAYQ
  AVVKSLGENDVMVILDNHVSQPGWCCSNLDGNGFFGDQYFDPDLWIMGLTKMATIFKGVTNVVAMSLRNELRGPRQNVNVWYRYMPKGAEAVHAANPDVL
  VILSGLNFDTNLSFIRNEAVKLSFNGKLVFEVHWYSFSDGQAWTLGNPNQVCGQVTENVMRRAGFLLDQGWPLFVSEFGVDLRGTSVNDNRYLNCFMALV
  AQLDLDWALWTLGGN
Full Sequence
Protein Sequence     Length: 545     Download
MIPLITVRVI VLLLLGVTLQ ITKPVVVKGF PLHTSERWIV DESGKRVKLA CVNWVSHLDA    60
VVAEGLSQQP LDEISKRIKT MGFNCVRLTW PLFLVTNDSI ASLTLRNSFQ NLGLIQSLNG    120
VQAINPSIID LPLIKAYQAV VKSLGENDVM VILDNHVSQP GWCCSNLDGN GFFGDQYFDP    180
DLWIMGLTKM ATIFKGVTNV VAMSLRNELR GPRQNVNVWY RYMPKGAEAV HAANPDVLVI    240
LSGLNFDTNL SFIRNEAVKL SFNGKLVFEV HWYSFSDGQA WTLGNPNQVC GQVTENVMRR    300
AGFLLDQGWP LFVSEFGVDL RGTSVNDNRY LNCFMALVAQ LDLDWALWTL GGNYYIRQGD    360
VGMEEYFGIL NSDWIQVRNT SFLQRISAIQ LPFKGPGLSE AKPYKVIFHP LTGLCILRNS    420
PVEPLMRLGP CSNSDAWEYT DQKILSIKGT YFCLQAEEEG KQAKLGNACS GSNSRWEMIS    480
DSKMHLSTQT NNASGVCLDV DTNNIIVTNI CQCLSKDNTC DPATQWFKLV DSTRKSRHYL    540
RIPS*                                                                600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
smart00458RICIN0.001407526126+
cd00161RICIN3.0e-5404529134+
pfam00150Cellulase1.0e-1340353321+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAD31066.10305443520AC007357_15 F3F19.15 [Arabidopsis thaliana]
RefSeqXP_002285424.101954418541PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002312657.10275367515predicted protein [Populus trichocarpa]
RefSeqXP_002315653.10295362508predicted protein [Populus trichocarpa]
RefSeqXP_002515055.102754429548hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1vrx_B0.00000000000001333777339A Chain A, Endocellulase E1 From Acidothermus Cellulolyticus Mutant Y245g
PDB1vrx_A0.00000000000001333777339A Chain A, Endocellulase E1 From Acidothermus Cellulolyticus Mutant Y245g
PDB1ece_B0.0000000000001333777339A Chain A, Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose
PDB1ece_A0.0000000000001333777339A Chain A, Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose
Signal Peptide
Cleavage Site
29
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DY282456286233080
GO2622632691474150
CB290890269423100
DY977776290633520
FN7505302721594300
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_011_00429.2Aquca_011_00429.1Aquca_001_00170.1Aquca_001_00171.1Aquca_011_00425.1
Aquca_011_00424.1Aquca_011_00428.1Aquca_011_00423.1Aquca_001_00172.1
Arabidopsis lyrata471466322756864961488616326109
882032
Arabidopsis thalianaAT5G17500.1AT1G13130.1AT3G26140.1AT3G26130.1AT5G16700.1
Brachypodium distachyonBradi5g13560.1Bradi5g13550.1
Brassica rapaBra025186Bra019811Bra025187Bra026437Bra026436
Bra023580Bra013972Bra008603Bra026925
Carica papayaevm.model.supercontig_33.65evm.model.supercontig_33.69evm.model.supercontig_33.67
Capsella rubellaCarubv10008758mCarubv10019167mCarubv10016955mCarubv10002868m
Citrus clementinaCiclev10031098mCiclev10023534m
Citrus sinensisorange1.1g013842morange1.1g008330morange1.1g015062morange1.1g039248m
Cucumis sativusCucsa.286780.1Cucsa.275330.1Cucsa.115540.1Cucsa.108400.1Cucsa.115550.1
Cucsa.365480.1Cucsa.303610.1Cucsa.303620.1Cucsa.129000.1Cucsa.275320.1
Eucalyptus grandisEucgr.B03243.1Eucgr.H02462.1Eucgr.H02464.1Eucgr.H02457.1Eucgr.H02458.1
Eucgr.D01800.1
Glycine maxGlyma05g30691.1Glyma05g30681.1Glyma08g13880.2Glyma18g01630.1Glyma08g13891.1
Glyma08g06511.1Glyma07g08060.2
Gossypium raimondiiGorai.002G188600.1Gorai.012G173600.1
Linum usitatissimumLus10011404Lus10006462Lus10011403Lus10006461Lus10024686
Lus10032312
Malus domesticaMDP0000753366MDP0000729817
Manihot esculentacassava4.1_004696mcassava4.1_031675mcassava4.1_025125m
Medicago truncatulaMedtr4g091610.1Medtr7g012780.1Medtr7g012530.1Medtr3g086450.1Medtr7g012540.1
Medtr7g012840.1Medtr5g088330.1
Mimulus guttatusmgv1a004205mmgv1a018920mmgv1a020519mmgv1a004243mmgv1a004297m
Oryza sativaLOC_Os04g40510.2LOC_Os04g40510.1LOC_Os02g38260.1LOC_Os04g40500.1LOC_Os04g40490.1
Panicum virgatumPavirv00025159mPavirv00029795mPavirv00010845mPavirv00023661mPavirv00002791m
Pavirv00002936m
Physcomitrella patensPp1s94_121V6.1Pp1s114_176V6.1Pp1s298_71V6.1
Phaseolus vulgarisPhvul.002G258500.1Phvul.011G098000.1Phvul.002G258400.1Phvul.002G220300.1Phvul.010G095100.1
Picea abiesMA_318998g0010MA_463555g0010MA_8507901g0010MA_10432675g0010
Populus trichocarpaPotri.008G183400.2Potri.008G183400.1Potri.010G049700.1Potri.010G049800.1Potri.008G183400.3
Potri.001G097900.1Potri.T144300.1
Prunus persicappa003807m
Ricinus communis29929.m00479230190.m01129330190.m01129230190.m011291
Setaria italicaSi019475mSi009742mSi009751mSi009695m
Sorghum bicolorSb06g020270.1Sb06g020260.1Sb04g024910.1
Thellungiella halophilaThhalv10007253mThhalv10003934mThhalv10004045mThhalv10003968mThhalv10015581m
Thhalv10015466m
Vitis viniferaGSVIVT01000573001GSVIVT01019434001.470.783GSVIVT01019434001.470.783GSVIVT01019434001.35.351GSVIVT01019434001.35.351
GSVIVT01019433001GSVIVT01019436001GSVIVT01014359001GSVIVT01014358001GSVIVT01014355001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)