y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma11g35630.1
FamilyGH85
Protein PropertiesLength: 731 Molecular Weight: 82128.9 Isoelectric Point: 5.3737
ChromosomeChromosome/Scaffold: 11 Start: 37260206 End: 37267936
DescriptionGlycosyl hydrolase family 85
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH851374180
  MAGGYLDDKWVQGGTNPDAYAIWHWHLIDVFVYFSHSLVTLPPPSWTNTAHRHGVKVLGTFITEWDEGKAVCDTMLSTKETAHMYAERLAELAADLGFDG
  WLINMEVNLDPGQISNLKEFVAHLSLTMHSSVPGSLVIWYDSVTVDGKLNWQDQLNEHNKPFFDICDGIFVNYTWKEDYPRLSAAVASDRKFDVYMGIDI
  FGRNTYGGGQWNVNVALDVIKKNDVSAAIFAPGWVYETKQPPDFQTAQNSWWGLVEKSWGVLQKLPGVLPFYTNFDQGRGYH
Full Sequence
Protein Sequence     Length: 731     Download
MLKLKNNKKH HVHRKSEVSV TKSWCAMIPW LLGAAYINRQ FLINVRNILL FFLDAIQTPF    60
LFLIFIMSNP KSESVVSEPS DSEPSIPISY PIKTLSELES RSYFESFHYP FNKASSSVNN    120
SSSSLPNRRR LLVCHDMAGG YLDDKWVQGG TNPDAYAIWH WHLIDVFVYF SHSLVTLPPP    180
SWTNTAHRHG VKVLGTFITE WDEGKAVCDT MLSTKETAHM YAERLAELAA DLGFDGWLIN    240
MEVNLDPGQI SNLKEFVAHL SLTMHSSVPG SLVIWYDSVT VDGKLNWQDQ LNEHNKPFFD    300
ICDGIFVNYT WKEDYPRLSA AVASDRKFDV YMGIDIFGRN TYGGGQWNVN VALDVIKKND    360
VSAAIFAPGW VYETKQPPDF QTAQNSWWGL VEKSWGVLQK LPGVLPFYTN FDQGRGYHIS    420
VDGDNVSDAT WCNISCQGFQ PLLESVDPTN SIQVSVDLKE ASYSGGGNIT FKGSLEEQTY    480
YESKIFQGEF LLNDLPIHFI YSVKSDGNSS LGLKLEFTST SNKRASVLLT SRAVNRFSSK    540
FSKIVMTREH KGLSSGWVIN EGVVAMNGYT LTEIHAVCYG SNDNDETLAS PSDYFALLGH    600
ITIKTSDYKS YFPVSSSWLV DGSCIKWTSD PLGSKTLDVK ISWKLKNGQN FLFLKYNVYL    660
VKLSKQDVGI TLEDVKEYLG VAQVNCFYVS DLEVPSDTSS LKFIIQVCGV DGTIQELDES    720
PYYQLEVEDP *                                                         780
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd02874GH18_CFLE_spore_hydrolase0.0003162265112+
cd00598GH18_chitinase-like3.0e-6137292175+
COG4724COG47247.0e-38148518409+
pfam03644Glyco_hydro_851.0e-121137421304+
cd06547GH85_ENGase4.0e-131134450337+
Gene Ontology
GO TermDescription
GO:0005737cytoplasm
GO:0033925mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqXP_002273683.10717287688PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002315137.108572826697predicted protein [Populus trichocarpa]
RefSeqXP_002315138.108272824694predicted protein [Populus trichocarpa]
RefSeqXP_002520781.107172810691endo beta n-acetylglucosaminidase, putative [Ricinus communis]
RefSeqXP_002520784.108372821685endo beta n-acetylglucosaminidase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3fha_D2e-3016051683465A Chain A, Structure Of Endo-Beta-N-Acetylglucosaminidase A
PDB3fha_C2e-3016051683465A Chain A, Structure Of Endo-Beta-N-Acetylglucosaminidase A
PDB3fha_B2e-3016051683465A Chain A, Structure Of Endo-Beta-N-Acetylglucosaminidase A
PDB3fha_A2e-3016051683465A Chain A, Structure Of Endo-Beta-N-Acetylglucosaminidase A
PDB3fhq_F2e-3016051683465A Chain A, Structure Of Endo-Beta-N-Acetylglucosaminidase A
Transmembrane Domains
StartEnd
4867
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FF5416452723766440
EL4379372571564120
GR1077392421343750
JG6212242761824560
GW895450289263110
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_030_00225.1
Arabidopsis lyrata497439.76.201497439.76.201872478497439.204.302487338
497439.204.302
Arabidopsis thalianaAT5G05460.1AT3G11040.1
Brachypodium distachyonBradi1g14127.1
Brassica rapaBra034160Bra005854
Carica papayaevm.model.supercontig_19.130
Capsella rubellaCarubv10000369mCarubv10013078m
Chlamydomonas reinhardtiiCre13.g582250.t1.2
Citrus clementinaCiclev10031026m.70.259Ciclev10031026m.70.259Ciclev10030777m
Cucumis sativusCucsa.144380.1Cucsa.144370.1
Eucalyptus grandisEucgr.J00174.1
Fragaria vescamrna21040.1-v1.0-hybrid
Glycine maxGlyma14g06120.2Glyma18g40011.1Glyma02g43025.1Glyma14g06130.1Glyma14g06120.1
Glyma18g02770.1Glyma02g43020.2
Gossypium raimondiiGorai.012G079500.1Gorai.011G290600.1
Linum usitatissimumLus10017430Lus10007526
Manihot esculentacassava4.1_029708mcassava4.1_031267m
Medicago truncatulaMedtr3g071610.1
Mimulus guttatusmgv1a002327mmgv1a001722m
Oryza sativaLOC_Os05g27960.1
Physcomitrella patensPp1s13_33V6.2Pp1s13_33V6.1
Phaseolus vulgarisPhvul.001G245900.1
Picea abiesMA_10436931g0010MA_10435721g0010
Populus trichocarpaPotri.008G073000.1Potri.010G184300.1Potri.010G184300.2Potri.010G184200.1Potri.010G184200.2
Prunus persicappa015834m
Ricinus communis29729.m00228229729.m002279
Setaria italicaSi021368m
Selaginella moellendorffii61572
Sorghum bicolorSb09g016230.1
Thellungiella halophilaThhalv10012879mThhalv10020200m
Vitis viniferaGSVIVT01032751001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny