y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma11g37760.1
FamilyGH27
Protein PropertiesLength: 657 Molecular Weight: 73814 Isoelectric Point: 5.7346
ChromosomeChromosome/Scaffold: 11 Start: 38784644 End: 38790215
DescriptionMelibiase family protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH27281516.5e-21
  SESEQQQASIPPRGWNSYDSFCWTISEEEFLQSAEIVSQRLHDHGYEYVVVDYLWYRRKVEGAYHDSLGFDVIDEWGRMVPDPGRWPSSENGKGFTEVAN
  QVHSMGLKFGIHVMRGISTQAVNA
Full Sequence
Protein Sequence     Length: 657     Download
MKCFSLSSIS LFILLFLCSE SVSSQNVSES EQQQASIPPR GWNSYDSFCW TISEEEFLQS    60
AEIVSQRLHD HGYEYVVVDY LWYRRKVEGA YHDSLGFDVI DEWGRMVPDP GRWPSSENGK    120
GFTEVANQVH SMGLKFGIHV MRGISTQAVN ANTPILDTTM GGAYQESGRV WYAKDIAIPE    180
RACAWMSHGF MSVNTKLGAG KAFLRSLYEQ YAAWGVDFVK HDCIFGDDFD LNEISYVSEV    240
LKEFDRPIVY SLSPGTSATP AMAKDVSGLV NMYRITGDDW DTWGDVKAHF DITRDFSNAN    300
MIGAKGLMGN SWPDLDMLPF GWLTDPGSNE GPHRYSYLNL EEKKTQMTLW SMAKSPLMYG    360
GDVRKIDPST YDVITNPTLL EINSFSSNNM EFPYITSVNS EDQDLGRPMR RSSMEIKTSY    420
THSLGLTSCT ESKASGWASE SLNQYLERIC WKRSLGNKHL APFCVHKREL YFPFDEASMY    480
QEYHQRKHHL VATNRIKFCL DASPKRKLTS KEFKRGTFSP CSWDSNQMWE LNPNGTLVNS    540
YSGLCATVES SEDTINSGGL HSWIATGRKG EVYVAFFNLS EQKRVISAKT SDLAKVLPGR    600
DFSSCQGSEV WSGDAIEITQ GTLSTAVEVH GSALIVLNCN ESPLLSPKIE RKKENK*       660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02692PLN026925.0e-1938383350+
PLN02229PLN022294.0e-2138383349+
PLN02808PLN028081.0e-2338383349+
PLN03231PLN032313.0e-16538391359+
PLN02899PLN02899037639606+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABD32283.2016403645Glycoside hydrolase, clan GH-D; Ricin B-related lectin [Medicago truncatula]
EMBLCBI16803.10106398643unnamed protein product [Vitis vinifera]
RefSeqXP_002282325.10106428646PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002314588.103063923648predicted protein [Populus trichocarpa]
RefSeqXP_002530047.10363912639alpha-galactosidase/alpha-n-acetylgalactosaminidase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3cc1_B0293893347A Chain A, Crystal Structure Of A Putative Alpha-N-Acetylgalactosaminidase (Bh1870) From Bacillus Halodurans C-125 At 2.00 A Resolution
PDB3cc1_A0293893347A Chain A, Crystal Structure Of A Putative Alpha-N-Acetylgalactosaminidase (Bh1870) From Bacillus Halodurans C-125 At 2.00 A Resolution
PDB3a5v_A6e-19353876298A Chain A, Crystal Structure Of Alpha-Galactosidase I From Mortierella Vinacea
Signal Peptide
Cleavage Site
24
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7979563522706210
CX0480852841123950
HO7817983682535910
BW659075233372690
HO781798262272520.011
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_035_00017.2.41.148Aquca_035_00017.2.41.148Aquca_035_00017.2.41.148Aquca_035_00016.2.45.154Aquca_035_00016.2.45.154
Aquca_035_00016.2.45.154Aquca_035_00016.1.45.154Aquca_035_00016.1.45.154Aquca_035_00017.1.41.149Aquca_035_00017.1.41.149
Aquca_005_00148.7.50.161Aquca_005_00148.7.50.161Aquca_005_00148.4.50.161Aquca_005_00148.4.50.161Aquca_005_00148.4.50.161
Aquca_005_00148.2.50.161Aquca_005_00148.2.50.161Aquca_005_00148.2.50.161Aquca_005_00148.1.50.161Aquca_005_00148.1.50.161
Aquca_005_00148.1.50.161Aquca_005_00148.3.50.163Aquca_005_00148.3.50.163Aquca_005_00148.6.50.162Aquca_005_00148.6.50.162
Aquca_005_00148.5.50.162Aquca_005_00148.5.50.162
Arabidopsis lyrata487672.42.150487672.42.150487672.42.150487670.27.131487670.27.131
487670.27.131486071.43.163486071.43.163486071.43.163
Arabidopsis thalianaAT5G08380.1.32.147AT5G08380.1.32.147AT5G08380.1.32.147AT5G08370.1.28.133AT5G08370.1.28.133
AT5G08370.1.28.133AT3G56310.1.50.173AT3G56310.1.50.173AT3G56310.1.50.173
Brachypodium distachyonBradi3g29797.1.12.136Bradi3g29797.1.12.136Bradi3g29810.4.46.151Bradi3g29810.4.46.151Bradi3g29810.4.46.151
Bradi3g29810.3.46.151Bradi3g29810.3.46.151Bradi3g29810.2.46.151Bradi3g29810.2.46.151Bradi3g29810.1.46.151
Bradi3g29810.1.46.151Bradi3g29810.1.46.151Bradi1g17730.1.48.159Bradi1g17730.1.48.159Bradi1g17730.1.48.159
Brassica rapaBra028660.52.153Bra028660.52.153Bra028661.28.131Bra028661.28.131Bra028661.28.131
Bra007235.44.158Bra007235.44.158
Carica papayaevm.model.supercontig_27.80.42.152evm.model.supercontig_27.80.42.152evm.model.supercontig_27.80.42.152evm.model.supercontig_774.1.38.147evm.model.supercontig_774.1.38.147
Capsella rubellaCarubv10003074m.19.130Carubv10003074m.19.130Carubv10003074m.19.130
Citrus sinensisorange1.1g014963m.36.154orange1.1g014963m.36.154orange1.1g014862m.36.154orange1.1g014862m.36.154orange1.1g014862m.36.154
orange1.1g039407m.17.134orange1.1g039407m.17.134orange1.1g016207m.49.186orange1.1g016207m.49.186orange1.1g012852m.49.193
orange1.1g012852m.49.193orange1.1g012852m.49.193orange1.1g015338m.49.189orange1.1g015338m.49.189orange1.1g015338m.49.189
Cucumis sativusCucsa.281070.1.38.150Cucsa.281070.1.38.150Cucsa.281070.1.38.150Cucsa.144010.2.57.160Cucsa.144010.2.57.160
Cucsa.144010.2.57.160Cucsa.144010.1.77.180Cucsa.144010.1.77.180
Eucalyptus grandisEucgr.J00326.1.43.158Eucgr.J00326.1.43.158Eucgr.J00326.1.43.158Eucgr.J00325.1.43.157Eucgr.J00325.1.43.157
Eucgr.J00325.1.43.157Eucgr.H00669.4.42.156Eucgr.H00669.4.42.156Eucgr.H00669.3.42.156Eucgr.H00669.3.42.156
Eucgr.H00669.3.42.156Eucgr.H00669.2.42.156Eucgr.H00669.2.42.156Eucgr.H00669.2.42.156Eucgr.H00669.1.42.156
Eucgr.H00669.1.42.156Eucgr.H00669.1.42.156Eucgr.D00664.1.17.139Eucgr.D00664.1.17.139Eucgr.J00127.3.59.161
Eucgr.J00127.3.59.161Eucgr.J00127.3.59.161Eucgr.J00127.4.59.163Eucgr.J00127.4.59.163Eucgr.J00127.2.59.163
Eucgr.J00127.2.59.163Eucgr.J00127.1.59.163Eucgr.J00127.1.59.163Eucgr.G03128.2.59.163Eucgr.G03128.2.59.163
Eucgr.G03128.2.59.163Eucgr.G03128.1.59.164Eucgr.G03128.1.59.164
Fragaria vescamrna12197.1-v1.0-hybrid.210.323mrna12197.1-v1.0-hybrid.210.323mrna00767.1-v1.0-hybrid.43.152mrna00767.1-v1.0-hybrid.43.152mrna21333.1-v1.0-hybrid.56.162
mrna21333.1-v1.0-hybrid.56.162
Glycine maxGlyma09g40990.1.45.147Glyma09g40990.1.45.147Glyma09g40990.1.45.147Glyma18g44820.2.38.147Glyma18g44820.2.38.147
Glyma18g44820.1.38.147Glyma18g44820.1.38.147Glyma18g44820.1.38.147Glyma10g31765.1.46.159Glyma10g31765.1.46.159
Glyma10g31765.1.46.159Glyma10g31780.1.32.147Glyma10g31780.1.32.147Glyma16g33510.1.53.164Glyma16g33510.1.53.164
Glyma09g28920.1.56.165Glyma09g28920.1.56.165Glyma09g28920.1.56.165Glyma20g35850.2.52.157Glyma20g35850.2.52.157
Glyma20g35850.2.52.157Glyma16g34640.2.44.154Glyma16g34640.2.44.154Glyma06g14920.3.58.168Glyma06g14920.3.58.168
Glyma06g14920.2.58.168Glyma06g14920.2.58.168Glyma06g14920.1.58.168Glyma06g14920.1.58.168Glyma11g37760.2
Gossypium raimondiiGorai.012G136800.1.30.134Gorai.012G136800.1.30.134Gorai.012G136800.1.30.134Gorai.013G066400.1.39.145Gorai.013G066400.1.39.145
Gorai.013G066400.1.39.145Gorai.005G214100.1.12.132Gorai.005G214100.1.12.132Gorai.005G214100.1.12.132Gorai.011G025100.5.24.144
Gorai.011G025100.5.24.144Gorai.011G025100.1.65.185Gorai.011G025100.1.65.185Gorai.011G025100.1.65.185Gorai.011G025100.6.24.143
Gorai.011G025100.6.24.143Gorai.011G025100.3.24.143Gorai.011G025100.3.24.143Gorai.011G025100.3.24.143Gorai.011G025100.2.24.143
Gorai.011G025100.2.24.143Gorai.011G025100.2.24.143Gorai.009G170600.1.37.144Gorai.009G170600.1.37.144Gorai.011G025100.4.24.142
Gorai.011G025100.4.24.142Gorai.011G025100.4.24.142Gorai.011G207400.1.64.168Gorai.011G207400.1.64.168Gorai.011G207400.1.64.168
Gorai.011G207400.2.64.170Gorai.011G207400.2.64.170Gorai.011G207400.2.64.170Gorai.011G207400.3.64.155Gorai.011G207400.3.64.155
Linum usitatissimumLus10036176.11.122Lus10036176.11.122Lus10038305.10.123Lus10038305.10.123Lus10018260.37.144
Lus10018260.37.144Lus10018260.37.144Lus10034218.96.205Lus10034218.96.205Lus10029046.56.165
Lus10029046.56.165Lus10029046.56.165
Malus domesticaMDP0000841170.58.163MDP0000841170.58.163MDP0000841170.58.163MDP0000222212
Manihot esculentacassava4.1_023135m.40.142cassava4.1_023135m.40.142cassava4.1_023135m.40.142cassava4.1_008949m.39.140cassava4.1_008949m.39.140
cassava4.1_008949m.39.140cassava4.1_007792m.53.171cassava4.1_007792m.53.171cassava4.1_007792m.53.171cassava4.1_003569m
Medicago truncatulaMedtr6g069140.1.44.159Medtr6g069140.1.44.159Medtr3g086580.1
Mimulus guttatusmgv1a025145m.26.137mgv1a025145m.26.137mgv1a007693m.29.137mgv1a007693m.29.137mgv1a007643m.31.137
mgv1a007643m.31.137mgv1a006885m.56.159mgv1a006885m.56.159mgv1a006885m.56.159
Oryza sativaLOC_Os10g35110.2.51.157LOC_Os10g35110.2.51.157LOC_Os10g35110.2.51.157LOC_Os10g35110.1.51.157LOC_Os10g35110.1.51.157
LOC_Os10g35110.1.51.157LOC_Os10g35070.4.29.141LOC_Os10g35070.4.29.141LOC_Os10g35070.1.29.141LOC_Os10g35070.1.29.141
LOC_Os07g48160.1.46.156LOC_Os07g48160.1.46.156LOC_Os07g48160.1.46.156
Panicum virgatumPavirv00020784m.32.137Pavirv00020784m.32.137Pavirv00032797m.33.138Pavirv00032797m.33.138Pavirv00020382m.32.134
Pavirv00020382m.32.134
Physcomitrella patensPp1s19_295V6.1.77.178Pp1s19_295V6.1.77.178Pp1s19_295V6.1.77.178
Phaseolus vulgarisPhvul.004G135800.1.54.162Phvul.004G135800.1.54.162Phvul.008G081100.1.42.148Phvul.008G081100.1.42.148Phvul.008G081100.1.42.148
Phvul.009G142100.1.31.170Phvul.009G142100.1.31.170Phvul.009G142100.1.31.170
Picea abiesMA_96852g0010.27.141MA_96852g0010.27.141MA_41308g0010.23.132MA_41308g0010.23.132MA_41308g0010.23.132
MA_54403g0020.24.132MA_54403g0020.24.132MA_54403g0020.24.132MA_92663g0010.20.130MA_92663g0010.20.130
MA_92663g0010.20.130MA_92663g0010.20.130MA_10430490g0010MA_179817g0010.22.125MA_179817g0010.22.125
MA_179817g0010.22.125MA_10428107g0010.186.283MA_10428107g0010.186.283MA_10428107g0010.186.283MA_10434513g0010
Populus trichocarpaPotri.004G038100.3.39.144Potri.004G038100.3.39.144Potri.004G038100.1.41.146Potri.004G038100.1.41.146Potri.010G255200.1.56.163
Potri.010G255200.1.56.163Potri.018G152200.3.64.170Potri.018G152200.3.64.170Potri.018G152200.2.64.170Potri.018G152200.2.64.170
Potri.018G152200.1.64.170Potri.018G152200.1.64.170Potri.004G038100.2.39.142Potri.004G038100.2.39.142Potri.004G038100.2.39.142
Potri.010G118200.1.34.144Potri.010G118200.1.34.144Potri.010G118200.1.34.144Potri.019G056700.2.58.167Potri.019G056700.2.58.167
Potri.019G056700.2.58.167Potri.019G056700.1.58.167Potri.019G056700.1.58.167Potri.019G056700.1.58.167
Prunus persicappa007136m.12.118ppa007136m.12.118ppa007136m.12.118ppa006179m.45.160ppa006179m.45.160
ppa005977m.59.162ppa005977m.59.162
Ricinus communis29681.m001369.40.15129681.m001369.40.15129681.m001369.40.15130131.m007295.35.14930131.m007295.35.149
30131.m007295.35.14929851.m002360.32.14129851.m002360.32.141
Setaria italicaSi036212m.59.162Si036212m.59.162Si035849m.59.162Si035849m.59.162Si035904m.25.146
Si035904m.25.146Si035904m.25.146Si029987m.35.139Si029987m.35.139Si029987m.35.139
Si030003m.54.157Si030003m.54.157Si029907m.50.161Si029907m.50.161Si029907m.50.161
Selaginella moellendorffii163627.34.143163627.34.143163627.34.14378329.30.13278329.30.132
78329.30.13283268.29.13283268.29.13283268.29.13278263.18.123
78263.18.12378263.18.12378029.18.12378029.18.12378029.18.123
85032.50.15785032.50.157405482
Sorghum bicolorSb01g018400.1.32.166Sb01g018400.1.32.166Sb01g018410.1.29.142Sb01g018410.1.29.142Sb02g018600.1.32.169
Sb02g018600.1.32.169Sb02g042960.1.48.162Sb02g042960.1.48.162Sb02g042960.1.48.162
Thellungiella halophilaThhalv10013789m.45.153Thhalv10013789m.45.153Thhalv10013789m.45.153Thhalv10013749m.26.131Thhalv10013749m.26.131
Thhalv10013749m.26.131Thhalv10005987m.49.167Thhalv10005987m.49.167
Vitis viniferaGSVIVT01034337001.39.145GSVIVT01034337001.39.145GSVIVT01034337001.39.145GSVIVT01034334001.34.148GSVIVT01034334001.34.148
GSVIVT01034334001.34.148GSVIVT01006484001.22.142GSVIVT01006484001.22.142GSVIVT01006484001.22.142GSVIVT01034333001.33.144
GSVIVT01034333001.33.144GSVIVT01032699001.53.159GSVIVT01032699001.53.159GSVIVT01032699001.53.159
Volvox carteriVocar20008940m.31.134Vocar20008940m.31.134
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)