y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma12g01510.1
FamilyGH5
Protein PropertiesLength: 408 Molecular Weight: 46228.4 Isoelectric Point: 5.8734
ChromosomeChromosome/Scaffold: 12 Start: 910313 End: 912596
DescriptionGlycosyl hydrolase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH5453705.1e-33
  NGSPFLFNGFNSYWMMNVAADPNQRYKVSNVFREASAIGLTVCRTWAFSDGGNQSLQISPGLYNEAMFQALDFVVAEAKKYRVRLIFSLVNNYNDFGGRP
  QYVQWANSSGVPVANDDDFYTNPVVKGYYKNHVKRILTRINTITKTAYRDEPTIMAWELINEPRCQVDYSGKTINAWVQEMAPYVKSIDPMHLLEVGMEG
  FYGDSIPDRQQYNPGFQVGTDFVSNHLIKEIDFATIHAYPDNWLTGQNDTMQMAFMQRWMTSHWEDSRTILKKPLVFTEFGKSKKDPGYSIHARDSFMNV
  VYSSIYSFAQNGGTFAGGLVWQLLDE
Full Sequence
Protein Sequence     Length: 408     Download
MTSIMNLTRS MVILSILIST LVCEARLLRV TPGFVQTKDT ELVLNGSPFL FNGFNSYWMM    60
NVAADPNQRY KVSNVFREAS AIGLTVCRTW AFSDGGNQSL QISPGLYNEA MFQALDFVVA    120
EAKKYRVRLI FSLVNNYNDF GGRPQYVQWA NSSGVPVAND DDFYTNPVVK GYYKNHVKRI    180
LTRINTITKT AYRDEPTIMA WELINEPRCQ VDYSGKTINA WVQEMAPYVK SIDPMHLLEV    240
GMEGFYGDSI PDRQQYNPGF QVGTDFVSNH LIKEIDFATI HAYPDNWLTG QNDTMQMAFM    300
QRWMTSHWED SRTILKKPLV FTEFGKSKKD PGYSIHARDS FMNVVYSSIY SFAQNGGTFA    360
GGLVWQLLDE GMDPYDDGYE IVLSQNPSTS SVISQQSSKM VALEHIH*                 420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00150Cellulase1.0e-545330289+
COG3934COG39344.0e-2844379342+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAN34823.1054051408endo-beta-mannanase [Daucus carota]
EMBLCAC08208.101040613409(1-4)-beta-mannan endohydrolase [Coffea arabica]
RefSeqXP_002270023.10104069403PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002272344.101740615402PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002272567.102240620403PREDICTED: hypothetical protein [Vitis vinifera]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1rh9_A0344036372A Chain A, Family Gh5 Endo-Beta-Mannanase From Lycopersicon Esculentum (Tomato)
PDB3pzq_A04339221376A Chain A, Family Gh5 Endo-Beta-Mannanase From Lycopersicon Esculentum (Tomato)
PDB3pzo_A04339221376A Chain A, Family Gh5 Endo-Beta-Mannanase From Lycopersicon Esculentum (Tomato)
PDB3pzn_A04339221376A Chain A, Family Gh5 Endo-Beta-Mannanase From Lycopersicon Esculentum (Tomato)
PDB3pzm_A04339221376A Chain A, Family Gh5 Endo-Beta-Mannanase From Lycopersicon Esculentum (Tomato)
Signal Peptide
Cleavage Site
25
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
JK974111372334030
DT75574429673010
DV1579272721163870
DY974769282112910
DY967275281112900
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_008_00275.1Aquca_028_00132.1Aquca_036_00154.1Aquca_027_00015.1Aquca_017_00156.1
Aquca_036_00154.2Aquca_008_00275.2Aquca_010_00537.1Aquca_023_00122.1Aquca_023_00124.1
Aquca_023_00123.1Aquca_003_00212.1Aquca_023_00122.2Aquca_010_00537.3
Arabidopsis lyrata491940480902349416872461887017
470192478424
Arabidopsis thalianaAT4G28320.1AT2G20680.1AT5G01930.1AT3G10890.1AT5G66460.1
AT1G02310.1AT3G10900.1AT3G30540.1
Brachypodium distachyonBradi2g49680.1Bradi1g42770.1Bradi4g44336.1Bradi2g45790.1Bradi3g57920.1
Bradi1g03207.1Bradi4g44336.2
Brassica rapaBra026266Bra031137Bra036493Bra005662Bra034151
Bra036494Bra033312Bra012074Bra001383
Carica papayaevm.model.supercontig_34.173evm.model.supercontig_86.73evm.model.supercontig_6.153evm.model.supercontig_57.52evm.model.supercontig_21.96
Capsella rubellaCarubv10004854mCarubv10013751mCarubv10012718mCarubv10016461mCarubv10028560m
Carubv10011405mCarubv10015594mCarubv10016343m
Chlamydomonas reinhardtiiCre01.g048350.t1.2g8002.t2g8002.t1Cre02.g098000.t1.2g12094.t1
Cre07.g337750.t1.3
Citrus clementinaCiclev10015394mCiclev10011654mCiclev10001262mCiclev10020376mCiclev10023981m
Ciclev10025631m
Citrus sinensisorange1.1g014151morange1.1g014902morange1.1g014373morange1.1g012093morange1.1g014426m
orange1.1g015179morange1.1g016140morange1.1g013811morange1.1g048104m
Cucumis sativusCucsa.119110.1Cucsa.137700.1Cucsa.342570.1Cucsa.127590.1Cucsa.237330.1
Cucsa.237320.1
Eucalyptus grandisEucgr.A01823.1Eucgr.E03950.1Eucgr.K01032.1Eucgr.A00780.1Eucgr.K00548.1
Eucgr.K00551.1Eucgr.K00550.1Eucgr.I02413.1Eucgr.F02943.1Eucgr.F01879.1
Eucgr.K00551.3Eucgr.K00551.2
Fragaria vescamrna17714.1-v1.0-hybridmrna05501.1-v1.0-hybridmrna15177.1-v1.0-hybridmrna13566.1-v1.0-hybridmrna22956.1-v1.0-hybrid
Glycine maxGlyma13g37250.1Glyma12g33200.1Glyma06g44750.1Glyma12g12770.1Glyma03g00440.3
Glyma03g00440.2Glyma03g00440.1Glyma16g34630.3Glyma16g34630.2Glyma16g34630.1
Glyma19g41090.1Glyma09g41000.1Glyma03g38490.1Glyma18g44810.1Glyma14g07930.1
Glyma19g41410.2Glyma17g37090.1Glyma09g35840.1Glyma01g37720.2Glyma04g03270.1
Glyma06g03350.1Glyma03g38840.1Glyma11g07580.1Glyma01g37720.1
Gossypium raimondiiGorai.005G201100.1Gorai.010G186400.2Gorai.013G075700.1Gorai.010G186400.1Gorai.011G124800.1
Gorai.010G186400.3Gorai.009G200500.2Gorai.009G200500.1Gorai.007G119100.1Gorai.007G119100.2
Gorai.007G201600.1Gorai.005G120600.1Gorai.001G149200.1Gorai.007G119100.3
Linum usitatissimumLus10033687Lus10039833Lus10031650Lus10018598Lus10039032
Lus10027329Lus10014184Lus10014288Lus10025995Lus10007900
Lus10030347Lus10007210Lus10007211
Malus domesticaMDP0000322330MDP0000709705MDP0000417632MDP0000832632MDP0000321839
MDP0000120098MDP0000252855MDP0000281231MDP0000309661
Manihot esculentacassava4.1_008068mcassava4.1_027705mcassava4.1_006893mcassava4.1_008562mcassava4.1_025176m
cassava4.1_007999mcassava4.1_032265m
Medicago truncatulaMedtr4g078230.1Medtr8g005670.1Medtr8g005270.1Medtr7g111740.1Medtr5g020890.1
Medtr4g043760.1Medtr1g085310.1Medtr1g085350.1Medtr1g085320.1
Mimulus guttatusmgv1a007803mmgv1a005866mmgv1a005847mmgv1a006272mmgv1a025011m
mgv1a020287mmgv1a025294mmgv1a023976mmgv1a011066mmgv1a022814m
Oryza sativaLOC_Os01g54300.1LOC_Os06g20620.1LOC_Os12g02520.1LOC_Os02g52800.1LOC_Os01g47400.1
LOC_Os05g25480.1LOC_Os03g61280.2LOC_Os03g61280.1LOC_Os01g47400.2
Panicum virgatumPavirv00037971mPavirv00037189mPavirv00037030mPavirv00015019mPavirv00042163m
Pavirv00046651mPavirv00011599mPavirv00048102mPavirv00047147mPavirv00040471m
Pavirv00030867mPavirv00021810mPavirv00035248m
Physcomitrella patensPp1s180_63V6.1Pp1s41_160V6.1Pp1s23_181V6.2Pp1s429_16V6.1Pp1s22_64V6.1
Pp1s53_47V6.2Pp1s53_47V6.1Pp1s23_181V6.1Pp1s115_190V6.1Pp1s5_225V6.1
Pp1s83_137V6.1
Phaseolus vulgarisPhvul.004G108000.1Phvul.011G118900.1Phvul.010G058300.2Phvul.010G058300.1Phvul.008G081200.1
Phvul.001G219800.1Phvul.009G059700.1Phvul.002G033500.1Phvul.001G012600.1Phvul.001G223100.1
Picea abiesMA_10426380g0010MA_6558g0010MA_10427065g0010MA_58990g0010MA_894609g0010
MA_955078g0010MA_45718g0010MA_111906g0010MA_69814g0010MA_11130g0010
MA_110162g0010MA_953274g0010MA_38956g0010MA_10358593g0010MA_134938g0010
MA_10432193g0010MA_71720g0010
Populus trichocarpaPotri.013G130400.1Potri.006G009400.1Potri.016G138600.1Potri.006G109900.3Potri.016G138600.2
Potri.006G109900.2Potri.006G109900.1Potri.016G014800.1Potri.005G229600.3Potri.005G229600.2
Potri.005G229600.1Potri.005G120500.1Potri.007G022000.2Potri.007G022000.1Potri.002G184500.1
Prunus persicappa005783mppa006029mppa020168mppa005992mppa005849m
Ricinus communis29983.m00318529724.m00083229915.m00048630170.m01407330076.m004513
Setaria italicaSi006454mSi001340mSi019677mSi001544mSi010209m
Si024351mSi035445mSi027540m
Selaginella moellendorffii101148101525232427234867
Sorghum bicolorSb03g034420.1Sb10g011830.1Sb01g006080.1Sb04g034200.1Sb03g030340.1
Sb01g002630.1Sb05g001260.1
Thellungiella halophilaThhalv10025261mThhalv10001990mThhalv10013730mThhalv10020842mThhalv10004263m
Thhalv10007769m
Vitis viniferaGSVIVT01020553001GSVIVT01003344001GSVIVT01003349001GSVIVT01030163001GSVIVT01030165001
GSVIVT01009746001GSVIVT01037214001GSVIVT01037215001GSVIVT01037212001GSVIVT01037213001
GSVIVT01018923001GSVIVT01037211001GSVIVT01037216001
Volvox carteriVocar20006216m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)