y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma12g12750.1
FamilyGT48
Protein PropertiesLength: 779 Molecular Weight: 90652.6 Isoelectric Point: 9.8405
ChromosomeChromosome/Scaffold: 12 Start: 11053525 End: 11058574
Descriptionglucan synthase-like 5
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT484696342.29995e-41
  RSFVGQEKKRFAEIYRLFARSHFVKAIELGLILVIYASHSPVATDTFVYIALTITSWFLVASWIMAPFVFNPSGFDWLKTVYDFDDFMNWIWYSGSVFAK
  AEQSWERWWFEEQDHLKVTGLWGKLLEIILDLRFFFFQYGIVYQLGISDHNTSIAVYLLSWIYVFV
Full Sequence
Protein Sequence     Length: 779     Download
MSLRHRQSPA SVTSSAPGRG EEPFNIIPVH NLLADHPSLR FPEVRAAAAA LRAVGDLRRP    60
PFGQWRPNMD LLDWLALFFG FQRDNVRNQR EHLVLHLANA QMRLTPPPDN IDTLDAGVLR    120
RFRKKLLKNY TSWCSYLGKK SNIWISDRRG GAGDDLRREL LYVSLYLLIW GEAANLRFMP    180
ECICYIFHNM ANELNRILED FIDENTGQPV MPSVSGENAF LNLVVKPIYE TIKREVDSSR    240
NGTAPHSAWR NYDDINEYFW SRRCFEKLKW PLDIGSNFFV TAGGGGKHVG KTGFVEQRSF    300
WNLFRSFDRL WVMLILFLQA AIIVAWEGKT YPWQALEDRT VQVRVLTIFF TWSGLRFLQS    360
LLDVGMQYRL VSRETIGLGM RMVMKCVVAA GWIVVFGVFY ARIWTQRNQD RRWSPAANNR    420
VWNFLVVVFV FIIPELLAVA LFVIPWIRNF IENTNWRIFY MLSWWFQSRS FVGQEKKRFA    480
EIYRLFARSH FVKAIELGLI LVIYASHSPV ATDTFVYIAL TITSWFLVAS WIMAPFVFNP    540
SGFDWLKTVY DFDDFMNWIW YSGSVFAKAE QSWERWWFEE QDHLKVTGLW GKLLEIILDL    600
RFFFFQYGIV YQLGISDHNT SIAVYLLSWI YVFVVSGIYA VVVYARNKYA AKEHIYYRLV    660
QFLVIILAIL VIVGLLEFTK FKFMDIFTSL LAFIPTGWGL ISIAQVFRPF LQSTIIWDGV    720
VSVARIYDIM FGVIIMAPVA LLSWLPGFQN MQTRILFNEA FSRGLRIFQI VTGKKSQS*     780
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam02364Glucan_synthase4.0e-41469655212+
pfam14288FKS1_dom13.0e-58162273112+
Gene Ontology
GO TermDescription
GO:00001481,3-beta-D-glucan synthase complex
GO:00038431,3-beta-D-glucan synthase activity
GO:0006075(1->3)-beta-D-glucan biosynthetic process
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_192264.1014741478ATGSL05 (GLUCAN SYNTHASE-LIKE 5); 1,3-beta-glucan synthase/ transferase, transferring glycosyl groups [Arabidopsis thaliana]
RefSeqXP_002330632.102247417471predicted protein [Populus trichocarpa]
RefSeqXP_002330632.1046877611911497predicted protein [Populus trichocarpa]
RefSeqXP_002517915.1024743470transferase, transferring glycosyl groups, putative [Ricinus communis]
RefSeqXP_002517915.1047577614661767transferase, transferring glycosyl groups, putative [Ricinus communis]
Metabolic Pathways
Pathway NameReactionECProtein Name
callose biosynthesis13-BETA-GLUCAN-SYNTHASE-RXNEC-2.4.1.341,3-β-glucan synthase
Transmembrane Domains
StartEnd
310328
341358
378400
421443
486508
515537
593615
622644
654676
689711
726748
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7880212571884430
EC9380972894797670
FG8386762355197530
DY28342627722770
HO788021404234610.012
Orthologous Group
SpeciesID
Carica papayaevm.model.supercontig_50.99
Citrus clementinaCiclev10015387m
Gossypium raimondiiGorai.007G332800.1
Linum usitatissimumLus10000830Lus10014601
Malus domesticaMDP0000542728MDP0000624875MDP0000695519MDP0000138855
Manihot esculentacassava4.1_007052m
Oryza sativaLOC_Os06g02260.2LOC_Os06g02260.1
Panicum virgatumPavirv00049629mPavirv00005035mPavirv00035379mPavirv00002017mPavirv00014599m
Pavirv00001511m
Phaseolus vulgarisPhvul.009G169500.1
Picea abiesMA_40978g0030MA_111976g0010MA_10432652g0010MA_8263680g0010MA_10437131g0040
Setaria italicaSi032541m
Selaginella moellendorffii427055
Sorghum bicolorSb01g049270.1Sb01g050470.1
Thellungiella halophilaThhalv10029468m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny