y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma12g17165.1
FamilyGH1
Protein PropertiesLength: 153 Molecular Weight: 17554 Isoelectric Point: 7.013
ChromosomeChromosome/Scaffold: 12 Start: 17028764 End: 17030064
Descriptionbeta glucosidase 41
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH121376.6e-38
  LEDKYEGWLSSQIIKDYEHYAYTCFKAFGDRVKHWITFNEPHNFALHGYDLGIQAPGRCSLLVHLLCKKGKSSTDSYIVVHNILLSHAGAYRSYQIHFQG
  QQGGQIGIALDVIWYEPITELMKTKTQQQEVWTFHL
Full Sequence
Protein Sequence     Length: 153     Download
MLEDKYEGWL SSQIIKDYEH YAYTCFKAFG DRVKHWITFN EPHNFALHGY DLGIQAPGRC    60
SLLVHLLCKK GKSSTDSYIV VHNILLSHAG AYRSYQIHFQ GQQGGQIGIA LDVIWYEPIT    120
ELMKTKTQQQ EVWTFHLDGS LTRFSLENIL SQ*                                 180
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG2723BglB5.0e-2329594+
PLN02814PLN028143.0e-2429998+
PLN02849PLN028495.0e-272137136+
pfam00232Glyco_hydro_13.0e-272121120+
PLN02998PLN029981.0e-322137136+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAG90993.10213761196unnamed protein product [Oryza sativa Japonica Group]
EMBLCBI20471.101137222358unnamed protein product [Vitis vinifera]
RefSeqXP_002280323.101137146282PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002319794.101137158294predicted protein [Populus trichocarpa]
RefSeqXP_002530914.101137141277beta-glucosidase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3gnr_A02121139258A Chain A, Family Gh5 Endo-Beta-Mannanase From Lycopersicon Esculentum (Tomato)
PDB3gnp_A02121139258A Chain A, Family Gh5 Endo-Beta-Mannanase From Lycopersicon Esculentum (Tomato)
PDB3gno_A02121139258A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
PDB3scw_B9e-342137142273A Chain A, Crystal Structure Of Rice Bglu1 E386gY341A MUTANT COMPLEXED WITH Cellotetraose
PDB3scw_A9e-342137142273A Chain A, Crystal Structure Of Rice Bglu1 E386gY341A MUTANT COMPLEXED WITH Cellotetraose
Metabolic Pathways
Pathway NameReactionECProtein Name
coumarin biosynthesis (via 2-coumarate)RXN-8036EC-3.2.1.21β-glucosidase
linamarin degradationRXN-5341EC-3.2.1.21β-glucosidase
linustatin bioactivationRXN-13602EC-3.2.1.21β-glucosidase
linustatin bioactivationRXN-5341EC-3.2.1.21β-glucosidase
lotaustralin degradationRXN-9674EC-3.2.1.21β-glucosidase
neolinustatin bioactivationRXN-13603EC-3.2.1.21β-glucosidase
neolinustatin bioactivationRXN-9674EC-3.2.1.21β-glucosidase
taxiphyllin bioactivationRXN-13600EC-3.2.1.21β-glucosidase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GH16334911811180
FC06572812611260
DW05771612021210
EL38334513711370
DW07002212021210