y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma12g20860.1
FamilyGT31
Protein PropertiesLength: 287 Molecular Weight: 32907.9 Isoelectric Point: 8.2846
ChromosomeChromosome/Scaffold: 12 Start: 22343178 End: 22344267
DescriptionGalactosyltransferase family protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT31702073.7e-24
  RRNLLRLVYGTQPAPPGAKINVKFVFCNLTKEDQKVLVALEIMRYGDIIILDCKENMNNGKTLTYFSSLPEMLNDTASSYPPYHYMMKTDDDTYLRLNIL
  VQSLKPLSREDLYYGYVIPCRSIDPFVRYMSGMGYLFE
Full Sequence
Protein Sequence     Length: 287     Download
TGSFILSYVL ILVFLLILAS NQVQFKDTLR SSLTTTTTTS PQLTNYFSSN SDNNLRILIG    60
ILTLPDQHLR RNLLRLVYGT QPAPPGAKIN VKFVFCNLTK EDQKVLVALE IMRYGDIIIL    120
DCKENMNNGK TLTYFSSLPE MLNDTASSYP PYHYMMKTDD DTYLRLNILV QSLKPLSRED    180
LYYGYVIPCR SIDPFVRYMS GMGYLFEGPE DKVFGEWMRE GGKGKHRYNA KWSMFNFPEP    240
PTTCTHELWP ETIAVHLLKN QEKGFGIFNY FNVTHGLNPS KLFHIH*                  300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam01762Galactosyl_T1.0e-1170209165+
Gene Ontology
GO TermDescription
GO:0006486protein glycosylation
GO:0008378galactosyltransferase activity
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAM61378.103328550317unknown [Arabidopsis thaliana]
EMBLCAN80704.104528560317hypothetical protein [Vitis vinifera]
RefSeqNP_200558.101528523317transferase, transferring glycosyl groups [Arabidopsis thaliana]
RefSeqXP_002269659.104528579336PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002325062.10428512319predicted protein [Populus trichocarpa]
Transmembrane Domains
StartEnd
421
Signal Peptide
Cleavage Site
25
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EC939282251532850
EC938024246582850
FD582406209952850
CU530544211532450
CK290070213452370
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_096_00011.1Aquca_096_00008.1Aquca_096_00010.1Aquca_002_01354.1
Arabidopsis lyrata918927
Arabidopsis thalianaAT5G57500.1
Brachypodium distachyonBradi4g30950.1Bradi3g60170.1Bradi2g15440.1Bradi2g15450.1Bradi2g15460.1
Bradi2g17360.1Bradi4g04430.1Bradi4g16710.1Bradi4g30940.1
Brassica rapaBra002724Bra006816
Carica papayaevm.model.supercontig_52.13
Capsella rubellaCarubv10026744m
Citrus clementinaCiclev10010309m
Citrus sinensisorange1.1g020721m
Cucumis sativusCucsa.092450.1
Eucalyptus grandisEucgr.C00164.1
Fragaria vescamrna04896.1-v1.0-hybridmrna05246.1-v1.0-hybridmrna04895.1-v1.0-hybrid
Glycine maxGlyma13g01060.1Glyma17g07150.1
Gossypium raimondiiGorai.004G100500.1
Linum usitatissimumLus10015527Lus10000372Lus10006963Lus10000407Lus10019998
Manihot esculentacassava4.1_024374m
Medicago truncatulaMedtr4g128310.1
Mimulus guttatusmgv1a025682mmgv1a018717mmgv1a021117m
Oryza sativaLOC_Os09g26330.1LOC_Os02g54390.1LOC_Os09g26320.1LOC_Os02g54370.1LOC_Os05g47880.1
LOC_Os02g54450.1LOC_Os09g26310.1LOC_Os09g26300.1LOC_Os06g09270.1LOC_Os02g54420.1
Panicum virgatumPavirv00040114mPavirv00020399mPavirv00061634mPavirv00009580mPavirv00040113m
Pavirv00047142mPavirv00009581mPavirv00040592mPavirv00020786mPavirv00027671m
Pavirv00062025mPavirv00047141mPavirv00070843m
Physcomitrella patensPp1s111_120V6.1Pp1s111_120V6.2Pp1s111_120V6.3Pp1s121_91V6.1
Phaseolus vulgarisPhvul.003G146700.1
Picea abiesMA_877072g0010MA_119164g0010MA_118743g0010
Populus trichocarpaPotri.007G131000.1Potri.018G094000.1
Prunus persicappa015950mppa025342mppa022137m
Setaria italicaSi030530mSi019701mSi030596mSi022442mSi019638m
Si008283m
Sorghum bicolorSb09g027700.1Sb04g035240.1Sb02g025430.1Sb10g006180.1Sb04g035250.1
Sb02g025420.1
Thellungiella halophilaThhalv10014129m
Vitis viniferaGSVIVT01038267001GSVIVT01029188001GSVIVT01029189001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)