y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma12g30151.1
FamilyGH29
Protein PropertiesLength: 421 Molecular Weight: 47675.8 Isoelectric Point: 4.8381
ChromosomeChromosome/Scaffold: 12 Start: 33733421 End: 33736395
Descriptionalpha-L-fucosidase 1
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH29232640
  NPTKLNASQWIRVAKDSGFSLVILTVKHHDGFFLWPLITPIIRNWRNGNGGVVAELASAAKDAGVGLGFYLSRWDRHEACYGDTLRYNEFYLAQMTELLT
  RYGEIKDIFLDGTKGDGETEMNYLFDSWISLIHQLQPGATNFSDLGPDTRWIGNEYGAAGSTCWSLYNKTGCEIGYIDSQYNSEGDQFCPDWIPATCDVS
  IRPSWFWHASEQPKSLLLNVTPNSSGLISDEDIQILQEFTEL
Full Sequence
Protein Sequence     Length: 421     Download
MALFFHFGTN TFTDSEWGTG HSNPTKLNAS QWIRVAKDSG FSLVILTVKH HDGFFLWPLI    60
TPIIRNWRNG NGGVVAELAS AAKDAGVGLG FYLSRWDRHE ACYGDTLRYN EFYLAQMTEL    120
LTRYGEIKDI FLDGTKGDGE TEMNYLFDSW ISLIHQLQPG ATNFSDLGPD TRWIGNEYGA    180
AGSTCWSLYN KTGCEIGYID SQYNSEGDQF CPDWIPATCD VSIRPSWFWH ASEQPKSLLL    240
NVTPNSSGLI SDEDIQILQE FTELRSIRGG IQETHFSPYN VLEEGIYTYW APGENQTKWI    300
LYIDLQELVS FNILQLQEPI NMGQRVIEFH LEALSLDGVW MRVVYGTTIG YQRLLRFPKL    360
KSQYLKLVVD KLRRPVDIFG IYMDPVTVLS DLSDRKSGAC FNGGQVLQTT RNSSYLSATM    420
*                                                                    480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam01120Alpha_L_fucos8.0e-1823263279+
smart00812Alpha_L_fucos6.0e-1923302321+
COG3669COG36696.0e-424371408+
Gene Ontology
GO TermDescription
GO:0004560alpha-L-fucosidase activity
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_180377.20138450479ATFUC1 (alpha-L-fucosidase 1); alpha-L-fucosidase [Arabidopsis thaliana]
Swiss-ProtQ8GW720138450479FUCO1_ARATH RecName: Full=Alpha-L-fucosidase 1; AltName: Full=Alpha-L-fucoside fucohydrolase; AltName: Full=Alpha-1,3/4-fucosidase; Short=AtFUC1; Flags: Precursor
RefSeqXP_002276131.10140562509PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002313533.10138426454predicted protein [Populus trichocarpa]
RefSeqXP_002523703.10139175511alpha-l-fucosidase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3ues_B0137331465A Chain A, Crystal Structure Of Alpha-1,34-Fucosidase From Bifidobacterium Longum Subsp. Infantis Complexed With Deoxyfuconojirimycin
PDB3ues_A0137331465A Chain A, Crystal Structure Of Alpha-1,34-Fucosidase From Bifidobacterium Longum Subsp. Infantis Complexed With Deoxyfuconojirimycin
PDB3mo4_B0137333467A Chain A, The Crystal Structure Of An Alpha-(1-3,4)-Fucosidase From Bifidobacterium Longum Subsp. Infantis Atcc 15697
PDB3mo4_A0137333467A Chain A, The Crystal Structure Of An Alpha-(1-3,4)-Fucosidase From Bifidobacterium Longum Subsp. Infantis Atcc 15697
PDB3uet_B0137331465A Chain A, Crystal Structure Of Alpha-1,34-Fucosidase From Bifidobacterium Longum Subsp. Infantis D172aE217A MUTANT COMPLEXED WITH LACTO-N- Fucopentaose Ii
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CX7110362721864210
FK0168952582004210
CO9816631572654210
CO981663871962650
CX7080162402184210
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_013_00507.1Aquca_062_00017.1
Arabidopsis lyrata481700
Arabidopsis thalianaAT2G28100.1
Brachypodium distachyonBradi4g35500.1Bradi5g18220.1
Brassica rapaBra034388
Carica papayaevm.model.supercontig_65.36evm.model.supercontig_3.250
Capsella rubellaCarubv10023050m
Citrus clementinaCiclev10028463m.194.266Ciclev10004832mCiclev10028210mCiclev10028463m.194.266Ciclev10028463m.51.191
Ciclev10028463m.51.191
Citrus sinensisorange1.1g011170morange1.1g047217m
Cucumis sativusCucsa.385790.1Cucsa.193300.1
Eucalyptus grandisEucgr.J00379.2Eucgr.J00379.1Eucgr.J00367.1Eucgr.A02862.1Eucgr.A02861.1
Fragaria vescamrna13375.1-v1.0-hybridmrna28904.1-v1.0-hybridmrna13376.1-v1.0-hybrid
Glycine maxGlyma13g39750.2Glyma10g38670.2Glyma20g29080.1Glyma10g38670.1
Gossypium raimondiiGorai.004G231200.1Gorai.008G282700.1
Linum usitatissimumLus10016140Lus10027390Lus10031681Lus10021427
Malus domesticaMDP0000166406MDP0000271120MDP0000917175MDP0000295518
Manihot esculentacassava4.1_032976mcassava4.1_006636mcassava4.1_007875mcassava4.1_021316m
Medicago truncatulaMedtr1g102230.1Medtr2g095700.1
Mimulus guttatusmgv1a004219mmgv1a005268m
Oryza sativaLOC_Os09g34920.1LOC_Os04g47280.1
Panicum virgatumPavirv00068426mPavirv00016802mPavirv00061161m
Physcomitrella patensPp1s55_131V6.2Pp1s55_131V6.1
Phaseolus vulgarisPhvul.007G063900.1Phvul.005G131200.1
Picea abiesMA_16736g0010MA_171759g0010MA_8122188g0010
Populus trichocarpaPotri.015G133500.1Potri.009G006900.1Potri.012G131400.1
Prunus persicappa023537mppa005337m
Ricinus communis30147.m01415529589.m001240
Setaria italicaSi009874mSi029623m
Selaginella moellendorffii103164236749.37.121236749.37.121415432412246
236951112167158775103375431829
236749.167.333236749.167.333431838103154
Sorghum bicolorSb06g025200.1Sb02g030220.1
Thellungiella halophilaThhalv10016493mThhalv10016468m
Vitis viniferaGSVIVT01018468001.39.381GSVIVT01018468001.39.381GSVIVT01018468001.542.842GSVIVT01018468001.542.842GSVIVT01031495001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)