y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma12g34045.1
FamilyGT1
Protein PropertiesLength: 425 Molecular Weight: 47652.9 Isoelectric Point: 6.6385
ChromosomeChromosome/Scaffold: 12 Start: 37212648 End: 37213992
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT12093962.4e-25
  ILPEPPNSTLEEKWVSWLEGFNPGSVVFCAYGSEGSLPENQFQELLLGLEQAGFPFLAALKPPNGFESIEEAMPKGFGERVQGRGIVDEGWVPQQLILGH
  RSVGCFITHCGAASVTEALVNKCQLVFLPRLGADHIINARMFSRKLKVGVEVEKGEEDGLFTKESVCKAVKTVMEDETEVGREVRENH
Full Sequence
Protein Sequence     Length: 425     Download
MDAHAPSMHI AMFPWFAMGH FIPFLHLSNK LAKRGHKISF FTPRRTQTKL QHLNLHPHHI    60
TFVPINVPHV DGLPHDAETT SDVPSSLFPL IATAMDSTEK HIELLLRELK PQIVFFDFQH    120
WLPNITRSLG IKCIQYWILN PSTIAYLWNG PRQIQGGELT EVDLMKPPKG FPDSSIKLHA    180
HELRFLAATR KLEFGSGVFL YDRLGLGPIL PEPPNSTLEE KWVSWLEGFN PGSVVFCAYG    240
SEGSLPENQF QELLLGLEQA GFPFLAALKP PNGFESIEEA MPKGFGERVQ GRGIVDEGWV    300
PQQLILGHRS VGCFITHCGA ASVTEALVNK CQLVFLPRLG ADHIINARMF SRKLKVGVEV    360
EKGEEDGLFT KESVCKAVKT VMEDETEVGR EVRENHAKLR NFLLRDNLES TCVDGFCQQL    420
QDLL*                                                                480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN00164PLN001643.0e-28206400206+
PLN02670PLN026702.0e-708403445+
PLN02208PLN022082.0e-1176424451+
PLN00414PLN004142.0e-1219422447+
PLN02764PLN027645.0e-1229424455+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABL74480.1014241458glucosyltransferase [Ipomoea batatas]
GenBankACU24192.1054243457unknown [Glycine max]
DDBJBAD95881.1014241458glucosyltransferase [Ipomoea nil]
DDBJBAD95882.1014241458glucosyltransferase [Ipomoea purpurea]
RefSeqXP_002522508.1074245456UDP-glucosyltransferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vg8_A3e-24217411253457A Chain A, Crystal Structure Of Nasturtium Xyloglucan Hydrolase Isoform Nxg2
PDB2vch_A3e-24217411253457A Chain A, Crystal Structure Of Nasturtium Xyloglucan Hydrolase Isoform Nxg2
PDB2vce_A3e-24217411253457A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2c9z_A7e-21200400237426A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2c1z_A7e-21200400237426A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
Metabolic Pathways
Pathway NameReactionECProtein Name
anthocyanidin sophoroside metabolismRXN-8176EC-2.4.1cyanidin 3-O-glucoside 2''-O-glucosyltransferase
anthocyanidin sophoroside metabolismRXN-8177EC-2.4.1pelargonidin 3-O-glucoside 2''-O-glucosyltransferase
anthocyanidin sophoroside metabolismRXN-8178EC-2.4.1delphinidin 3-O-glucoside 2''-O-glucosyltransferase
superpathway of anthocyanin biosynthesis (from cyanidin and cyanidin 3-O-glucoside)RXN-8176EC-2.4.1cyanidin 3-O-glucoside 2''-O-glucosyltransferase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO778286426344240
FS28244820082070
GT14019520762120
FS259560192132030
HO7782862711370.0002
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_055_00117.1Aquca_038_00188.1Aquca_055_00115.1Aquca_023_00112.1Aquca_011_00587.1
Aquca_011_00580.1
Arabidopsis lyrata474186918511492036495482918509
475492
Arabidopsis thalianaAT3G29630.1AT5G53990.1AT5G54010.1AT5G54060.1AT1G64910.1
Brassica rapaBra029046Bra022688Bra029045
Carica papayaevm.model.supercontig_8.121
Capsella rubellaCarubv10027945m
Citrus clementinaCiclev10017784mCiclev10008184mCiclev10015186m
Citrus sinensisorange1.1g039043morange1.1g017557morange1.1g012080m
Cucumis sativusCucsa.032470.1Cucsa.148900.1Cucsa.148870.1Cucsa.148880.1Cucsa.180970.1
Eucalyptus grandisEucgr.F03293.1Eucgr.F03295.1Eucgr.K01076.1Eucgr.K01079.1Eucgr.F03297.1
Fragaria vescamrna16456.1-v1.0-hybridmrna27158.1-v1.0-hybridmrna20937.1-v1.0-hybridmrna29784.1-v1.0-hybridmrna13733.1-v1.0-hybrid
mrna16457.1-v1.0-hybrid
Glycine maxGlyma10g33790.1Glyma20g33810.1Glyma06g43880.1Glyma12g14050.1Glyma13g36500.1
Glyma13g36490.1Glyma06g35110.1Glyma12g34030.1Glyma08g44550.1Glyma13g32770.1
Gossypium raimondiiGorai.007G157200.1Gorai.002G066600.1Gorai.002G065400.1Gorai.002G065400.2Gorai.002G065300.1
Gorai.010G242800.1Gorai.002G065500.1Gorai.010G230400.1Gorai.010G230200.1Gorai.009G439200.1
Linum usitatissimumLus10008453Lus10013337Lus10040178
Malus domesticaMDP0000311492MDP0000729320MDP0000319451MDP0000729321
Manihot esculentacassava4.1_028194mcassava4.1_024244mcassava4.1_026854mcassava4.1_021802mcassava4.1_007290m
Medicago truncatulaMedtr4g079270.1Medtr4g079250.1Medtr2g014900.1Medtr2g083390.1Medtr2g083420.1
Mimulus guttatusmgv1a019428mmgv1a006277mmgv1a006102mmgv1a006231mmgv1a021196m
Panicum virgatumPavirv00057507m
Phaseolus vulgarisPhvul.007G135800.1Phvul.011G136400.1Phvul.011G115700.1Phvul.005G093600.1Phvul.011G128700.1
Phvul.011G138500.1Phvul.011G138600.1Phvul.005G093300.1Phvul.005G093500.2Phvul.005G093500.1
Populus trichocarpaPotri.011G061000.1Potri.011G060300.1Potri.006G179700.1Potri.011G097900.1
Prunus persicappa022356mppa024453m
Ricinus communis29900.m00155029705.m000575
Sorghum bicolorSb08g003060.1
Thellungiella halophilaThhalv10013536mThhalv10013535mThhalv10028656mThhalv10013471m
Vitis viniferaGSVIVT01014265001GSVIVT01014272001GSVIVT01014269001GSVIVT01014271001GSVIVT01014270001
GSVIVT01014267001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)