y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma12g35125.1
FamilyGH1
Protein PropertiesLength: 547 Molecular Weight: 62538.4 Isoelectric Point: 6.4064
ChromosomeChromosome/Scaffold: 12 Start: 38279831 End: 38289562
Descriptionbeta glucosidase 46
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1445150
  RSDFPEGFLFGTSTSSYQIEGAPFEDGRGLSNWDVFSHTPGKIKNDENGDIADDHYHRYLEDIELMSSLGVNVYRFSISWTRILPRGIYGDINPNGIMFY
  NKIIDNLLLRGIEPFVTIHHHDLPQELEERYGGWISLLMQRDFVHFAEICFKSFGDRVKYWTTINEPALVANYAYMKGIYAPGHCSPPFGNCNTGNSDVE
  PLIVVHNMLLAHAKAVELYRKHFQAKQGGTIGIVAHSVMYEPLRDEECDRQAVNRALAFLIPWVLDPLVFGEYPAEMHSILGSQLPVFSLKEKSLLKGSI
  DFIGINHYGSLYVKDCSLSACSLEADHPITGFVEVTGIRDGVPIGDQTGFSWFYVVPRGMQKLVDYVKIRYHNIPMYITENGYCSPLKPDETMHDLLQDV
  KRIDYHKAYLAALLRAIRKGADVRGYMIWSLLDNFEWANGYEIRYGLYHVNRDTHERIPKLSVQWFSSFLNN
Full Sequence
Protein Sequence     Length: 547     Download
MGAITSHTNK MKMLQRQLSV VMTLLCCVHF HVQCCDEVED AISRSDFPEG FLFGTSTSSY    60
QIEGAPFEDG RGLSNWDVFS HTPGKIKNDE NGDIADDHYH RYLEDIELMS SLGVNVYRFS    120
ISWTRILPRG IYGDINPNGI MFYNKIIDNL LLRGIEPFVT IHHHDLPQEL EERYGGWISL    180
LMQRDFVHFA EICFKSFGDR VKYWTTINEP ALVANYAYMK GIYAPGHCSP PFGNCNTGNS    240
DVEPLIVVHN MLLAHAKAVE LYRKHFQAKQ GGTIGIVAHS VMYEPLRDEE CDRQAVNRAL    300
AFLIPWVLDP LVFGEYPAEM HSILGSQLPV FSLKEKSLLK GSIDFIGINH YGSLYVKDCS    360
LSACSLEADH PITGFVEVTG IRDGVPIGDQ TGFSWFYVVP RGMQKLVDYV KIRYHNIPMY    420
ITENGYCSPL KPDETMHDLL QDVKRIDYHK AYLAALLRAI RKGADVRGYM IWSLLDNFEW    480
ANGYEIRYGL YHVNRDTHER IPKLSVQWFS SFLNNTIRTN ITEHLSEQQH TMFKSKDVRN    540
VDFNFI*                                                              600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02998PLN029988.0e-14243517480+
PLN02849PLN028492.0e-14740513481+
PLN02814PLN028142.0e-15840517481+
TIGR03356BGL7.0e-16248509467+
pfam00232Glyco_hydro_1047516474+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI20347.101752014505unnamed protein product [Vitis vinifera]
RefSeqXP_002281979.10752051552PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002281986.104754236527PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002329151.10445131469predicted protein [Populus trichocarpa]
RefSeqXP_002448169.104151320491hypothetical protein SORBIDRAFT_06g022410 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3gnr_A04151311486A Chain A, Pectin Methylesterase From Yersinia Enterocolitica
PDB3gnp_A04151311486A Chain A, Pectin Methylesterase From Yersinia Enterocolitica
PDB3gno_A04151311486A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
PDB3ptq_B03951326503A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
PDB3ptq_A03951326503A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
Metabolic Pathways
Pathway NameReactionECProtein Name
coumarin biosynthesis (via 2-coumarate)RXN-8036EC-3.2.1.21β-glucosidase
linamarin degradationRXN-5341EC-3.2.1.21β-glucosidase
linustatin bioactivationRXN-13602EC-3.2.1.21β-glucosidase
linustatin bioactivationRXN-5341EC-3.2.1.21β-glucosidase
lotaustralin degradationRXN-9674EC-3.2.1.21β-glucosidase
neolinustatin bioactivationRXN-13603EC-3.2.1.21β-glucosidase
neolinustatin bioactivationRXN-9674EC-3.2.1.21β-glucosidase
taxiphyllin bioactivationRXN-13600EC-3.2.1.21β-glucosidase
Signal Peptide
Cleavage Site
34
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FF5475362772214970
DY965900305613650
DY291078271343030
GO840911313243360
DY291078503023510.00002
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_012_00117.1Aquca_054_00059.1Aquca_054_00064.2Aquca_054_00061.2Aquca_054_00061.1
Aquca_054_00064.3Aquca_054_00064.1.216.582Aquca_054_00064.1.216.582Aquca_054_00060.1Aquca_054_00064.4
Aquca_054_00061.3Aquca_054_00061.4Aquca_054_00061.5Aquca_054_00061.6
Arabidopsis lyrata475147492699475148
Arabidopsis thalianaAT1G61820.1AT4G21760.1AT1G61810.1AT1G61810.3AT1G61820.3
Brachypodium distachyonBradi5g15540.1Bradi5g15527.1Bradi5g15540.3Bradi5g15540.2
Brassica rapaBra028383Bra031392Bra038756Bra013557Bra038755
Carica papayaevm.model.supercontig_198.21
Capsella rubellaCarubv10021428mCarubv10020143mCarubv10021331mCarubv10006876m
Citrus clementinaCiclev10007996mCiclev10014887mCiclev10017801m
Citrus sinensisorange1.1g009535morange1.1g014339morange1.1g045534morange1.1g016308morange1.1g012716m
orange1.1g016444morange1.1g016438morange1.1g022079m
Cucumis sativusCucsa.341820.2Cucsa.341820.1Cucsa.123340.1Cucsa.086000.1Cucsa.341820.3
Cucsa.341810.1
Eucalyptus grandisEucgr.H00071.1Eucgr.H02855.1Eucgr.E04103.1Eucgr.H02856.1Eucgr.H02856.2
Fragaria vescamrna19575.1-v1.0-hybrid
Glycine maxGlyma15g11290.2Glyma13g35430.2Glyma07g38840.1Glyma07g38850.1Glyma12g35140.2
Glyma13g35410.2Glyma13g35410.3Glyma13g35410.4
Gossypium raimondiiGorai.010G178500.1Gorai.010G178800.1Gorai.013G167400.1Gorai.013G167400.2Gorai.013G167400.4
Gorai.011G016100.1.462.724Gorai.011G016100.1.462.724Gorai.013G167400.5Gorai.013G167400.3.150.447Gorai.013G167400.3.150.447
Gorai.013G167400.6
Linum usitatissimumLus10018353Lus10007656Lus10007655Lus10032660Lus10018354
Lus10032659
Malus domesticaMDP0000140817MDP0000213598MDP0000306738MDP0000149337
Manihot esculentacassava4.1_005677mcassava4.1_032622mcassava4.1_031147mcassava4.1_026351m
Medicago truncatulaMedtr4g131800.1Medtr4g131810.1
Mimulus guttatusmgv1a004080m
Oryza sativaLOC_Os04g43360.1LOC_Os04g43410.1LOC_Os04g43390.2LOC_Os04g43360.2LOC_Os04g43390.1
LOC_Os04g43400.1LOC_Os04g43380.1
Panicum virgatumPavirv00042435mPavirv00070823mPavirv00006566mPavirv00021804mPavirv00059033m
Pavirv00006565mPavirv00036311mPavirv00010790m
Physcomitrella patensPp1s22_312V6.2Pp1s22_312V6.1
Phaseolus vulgarisPhvul.005G082900.1Phvul.005G082800.3Phvul.005G082800.2Phvul.005G082800.1Phvul.007G273800.1
Phvul.003G076700.1Phvul.006G151300.1Phvul.003G076800.1Phvul.006G151400.1Phvul.003G076700.2
Picea abiesMA_10431526g0010MA_119280g0010
Populus trichocarpaPotri.004G019800.1Potri.004G019700.1Potri.004G019500.1Potri.004G019300.1Potri.004G019300.2
Potri.001G403900.1Potri.004G019400.1
Prunus persicappa004523mppa025660mppa005194mppa017816m
Ricinus communis29842.m00362929904.m002964
Setaria italicaSi009837mSi009886mSi009882mSi009894mSi009871m
Si009850mSi010127mSi010115mSi010284mSi010346m
Si010332mSi010833m
Sorghum bicolorSb06g022460.1Sb06g022450.1Sb06g022510.1Sb06g022500.1Sb06g022410.1
Sb06g022490.1Sb06g022420.1Sb06g022385.1
Thellungiella halophilaThhalv10024134mThhalv10024920mThhalv10024911mThhalv10023411mThhalv10024896m
Vitis viniferaGSVIVT01014400001GSVIVT01012650001GSVIVT01014399001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)