y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma12g35831.1
FamilyGT22
Protein PropertiesLength: 565 Molecular Weight: 64084.5 Isoelectric Point: 8.3749
ChromosomeChromosome/Scaffold: 12 Start: 38955728 End: 38961721
DescriptionAlg9-like mannosyltransferase family
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT22454450
  VALGLLRYMSATSNIIHDCDEVFNYWEPLHFLLYKTGFQTWEYSSQFALRSYLYLLFHEIVGRPASWLFSEDKVRVFYAVRFFLGLLSVLTDTVLVVALS
  RKYGKRLATYALAMLCLTSGCFFASTSFLPSSFSMYAISLASGLFLLDKPAAAISVAVIGVILGWPFSILAFLPVTLYSLSRKFKEAFISAAVTSIILLA
  LSIVTDFYYYGKWTSSVLNLLIYNVAGGGESHLYGTEGPLYYLRNGFNNFNFCFVLALLFLGILPIAKKKYAPDLLIVISPIYIWLGFMSLQPHKEERFL
  YPIYPLICVAASAVIESFPDFFRSKYNPYDRSIIVTVAKVMRPVVLSLILYASHARTFSLINGYSAPLEVYKILEHHDAENNSVLCIGSEWHRFPSSFFI
  P
Full Sequence
Protein Sequence     Length: 565     Download
MALSAVRQRR SEPSDPSPSE PYTKLDKPEK AEEKDEGLGW VFPFVALGLL RYMSATSNII    60
HDCDEVFNYW EPLHFLLYKT GFQTWEYSSQ FALRSYLYLL FHEIVGRPAS WLFSEDKVRV    120
FYAVRFFLGL LSVLTDTVLV VALSRKYGKR LATYALAMLC LTSGCFFAST SFLPSSFSMY    180
AISLASGLFL LDKPAAAISV AVIGVILGWP FSILAFLPVT LYSLSRKFKE AFISAAVTSI    240
ILLALSIVTD FYYYGKWTSS VLNLLIYNVA GGGESHLYGT EGPLYYLRNG FNNFNFCFVL    300
ALLFLGILPI AKKKYAPDLL IVISPIYIWL GFMSLQPHKE ERFLYPIYPL ICVAASAVIE    360
SFPDFFRSKY NPYDRSIIVT VAKVMRPVVL SLILYASHAR TFSLINGYSA PLEVYKILEH    420
HDAENNSVLC IGSEWHRFPS SFFIPDYVGQ VQWIDDGFRG LLPFPFNSTL GGTAAAPPYF    480
NDKNMASDKQ YLHDVVACTF LVELQLKRPY LTRGSDLSTW EPIAALPYLD RELSPALYRS    540
FFIPYLWQEK NVFGMYKLLK RRTT*                                          600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02816PLN028160.002229350125+
pfam03901Glyco_transf_221.0e-8940445434+
Gene Ontology
GO TermDescription
GO:0006506GPI anchor biosynthetic process
GO:0016757transferase activity, transferring glycosyl groups
GO:0031227intrinsic to endoplasmic reticulum membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN72375.1045613567hypothetical protein [Vitis vinifera]
EMBLCBI20196.10535611510unnamed protein product [Vitis vinifera]
RefSeqXP_002285438.1045613567PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002316862.1065611563predicted protein [Populus trichocarpa]
RefSeqXP_002523375.1015611566glycosyltransferase, putative [Ricinus communis]
Metabolic Pathways
Pathway NameReactionECProtein Name
dolichyl-diphosphooligosaccharide biosynthesisRXN-5467EC-2.4.1.259Dol-P-Man:Man6GlcNAc2-PP-Dol α-1,2-mannosyltransferase
dolichyl-diphosphooligosaccharide biosynthesisRXN-5469EC-2.4.1.261Dol-P-Man:Man8GlcNAc2-PP-Dol α-1,2-mannosyltransferase
Transmembrane Domains
StartEnd
122144
151173
197219
232254
286308
315333
343362
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CO9833272453215650
EL453002308493520
FE710667286283120
GT0350883352135450
FG8702802273065320
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_021_00239.3Aquca_021_00239.2Aquca_021_00239.1
Arabidopsis lyrata471892
Arabidopsis thalianaAT1G16900.1
Brachypodium distachyonBradi2g06627.1Bradi2g06627.2
Brassica rapaBra016625Bra026017
Carica papayaevm.model.supercontig_97.103
Capsella rubellaCarubv10008988mCarubv10008626m
Citrus clementinaCiclev10019496m
Citrus sinensisorange1.1g009200morange1.1g008307m
Cucumis sativusCucsa.057600.1
Eucalyptus grandisEucgr.F01228.1
Fragaria vescamrna27242.1-v1.0-hybrid
Glycine maxGlyma13g34570.2Glyma12g35831.2Glyma13g34570.1
Gossypium raimondiiGorai.013G173400.1
Linum usitatissimumLus10028153Lus10042853
Malus domesticaMDP0000250399MDP0000193605
Manihot esculentacassava4.1_004544m
Medicago truncatulaMedtr2g076680.1
Mimulus guttatusmgv1a003735m
Oryza sativaLOC_Os01g11070.1
Panicum virgatumPavirv00044939m
Physcomitrella patensPp1s478_15V6.1
Phaseolus vulgarisPhvul.005G066500.1
Picea abiesMA_10429532g0010
Populus trichocarpaPotri.011G110800.1Potri.011G110800.2Potri.011G110800.3
Prunus persicappa003475m
Ricinus communis28842.m000906
Setaria italicaSi000820m
Selaginella moellendorffii442454
Sorghum bicolorSb03g002210.1
Thellungiella halophilaThhalv10007218m
Vitis viniferaGSVIVT01014208001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny