y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma12g35831.2
FamilyGT22
Protein PropertiesLength: 491 Molecular Weight: 55391.9 Isoelectric Point: 8.9591
ChromosomeChromosome/Scaffold: 12 Start: 38955728 End: 38961721
DescriptionAlg9-like mannosyltransferase family
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT22153710
  SQFALRSYLYLLFHEIVGRPASWLFSEDKVRVFYAVRFFLGLLSVLTDTVLVVALSRKYGKRLATYALAMLCLTSGCFFASTSFLPSSFSMYAISLASGL
  FLLDKPAAAISVAVIGVILGWPFSILAFLPVTLYSLSRKFKEAFISAAVTSIILLALSIVTDFYYYGKWTSSVLNLLIYNVAGGGESHLYGTEGPLYYLR
  NGFNNFNFCFVLALLFLGILPIAKKKYAPDLLIVISPIYIWLGFMSLQPHKEERFLYPIYPLICVAASAVIESFPDFFRSKYNPYDRSIIVTVAKVMRPV
  VLSLILYASHARTFSLINGYSAPLEVYKILEHHDAENNSVLCIGSEWHRFPSSFFIP
Full Sequence
Protein Sequence     Length: 491     Download
MVLTNDKWCV LGCSSQFALR SYLYLLFHEI VGRPASWLFS EDKVRVFYAV RFFLGLLSVL    60
TDTVLVVALS RKYGKRLATY ALAMLCLTSG CFFASTSFLP SSFSMYAISL ASGLFLLDKP    120
AAAISVAVIG VILGWPFSIL AFLPVTLYSL SRKFKEAFIS AAVTSIILLA LSIVTDFYYY    180
GKWTSSVLNL LIYNVAGGGE SHLYGTEGPL YYLRNGFNNF NFCFVLALLF LGILPIAKKK    240
YAPDLLIVIS PIYIWLGFMS LQPHKEERFL YPIYPLICVA ASAVIESFPD FFRSKYNPYD    300
RSIIVTVAKV MRPVVLSLIL YASHARTFSL INGYSAPLEV YKILEHHDAE NNSVLCIGSE    360
WHRFPSSFFI PDYVGQVQWI DDGFRGLLPF PFNSTLGGTA AAPPYFNDKN MASDKQYLHD    420
VVACTFLVEL QLKRPYLTRG SDLSTWEPIA ALPYLDRELS PALYRSFFIP YLWQEKNVFG    480
MYKLLKRRTT *                                                         540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02816PLN028160.002155276125+
pfam03901Glyco_transf_224.0e-6914371385+
Gene Ontology
GO TermDescription
GO:0006506GPI anchor biosynthetic process
GO:0016757transferase activity, transferring glycosyl groups
GO:0031227intrinsic to endoplasmic reticulum membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN72375.101448793567hypothetical protein [Vitis vinifera]
EMBLCBI20196.101448736510unnamed protein product [Vitis vinifera]
RefSeqXP_002285438.101448793567PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002316862.101448790563predicted protein [Populus trichocarpa]
RefSeqXP_002523375.101448792566glycosyltransferase, putative [Ricinus communis]
Metabolic Pathways
Pathway NameReactionECProtein Name
dolichyl-diphosphooligosaccharide biosynthesisRXN-5467EC-2.4.1.259Dol-P-Man:Man6GlcNAc2-PP-Dol α-1,2-mannosyltransferase
dolichyl-diphosphooligosaccharide biosynthesisRXN-5469EC-2.4.1.261Dol-P-Man:Man8GlcNAc2-PP-Dol α-1,2-mannosyltransferase
Transmembrane Domains
StartEnd
4769
81103
123145
158180
212234
241259
269288
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CO9833272452474910
GT0350883351394710
FG8702802272324580
EC3655242941894810
GT0054232512384870
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_021_00239.3Aquca_021_00239.2Aquca_021_00239.1
Arabidopsis lyrata471892
Arabidopsis thalianaAT1G16900.1
Brachypodium distachyonBradi2g06627.1Bradi2g06627.2
Brassica rapaBra016625Bra026017
Carica papayaevm.model.supercontig_97.103
Capsella rubellaCarubv10008988mCarubv10008626m
Citrus clementinaCiclev10019496m
Citrus sinensisorange1.1g009200morange1.1g008307m
Cucumis sativusCucsa.057600.1
Eucalyptus grandisEucgr.F01228.1
Fragaria vescamrna27242.1-v1.0-hybrid
Glycine maxGlyma13g34570.2Glyma12g35831.1Glyma13g34570.1
Gossypium raimondiiGorai.013G173400.1
Linum usitatissimumLus10028153Lus10042853
Malus domesticaMDP0000250399MDP0000193605
Manihot esculentacassava4.1_004544m
Medicago truncatulaMedtr2g076680.1
Mimulus guttatusmgv1a003735m
Oryza sativaLOC_Os01g11070.1
Panicum virgatumPavirv00044939m
Physcomitrella patensPp1s478_15V6.1
Phaseolus vulgarisPhvul.005G066500.1
Picea abiesMA_10429532g0010
Populus trichocarpaPotri.011G110800.1Potri.011G110800.2Potri.011G110800.3
Prunus persicappa003475m
Ricinus communis28842.m000906
Setaria italicaSi000820m
Selaginella moellendorffii442454
Sorghum bicolorSb03g002210.1
Thellungiella halophilaThhalv10007218m
Vitis viniferaGSVIVT01014208001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny