y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma12g35950.2
FamilyGT4
Protein PropertiesLength: 360 Molecular Weight: 39998 Isoelectric Point: 7.8532
ChromosomeChromosome/Scaffold: 12 Start: 39059313 End: 39063607
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT41643268.60001e-40
  FLSINRFERKKNIQLAISAFAMLNSPEGVLKHKDITNASLTIAGGFDKRLKENVEYLEELKDLAEKEGVSNKIRFITSCSTAERNELLSECLCVLYTPKD
  EHFGIVPLEAMAAYKPVIACNSGGPVESIKNGVTGFLCDPTPQEFSLAMAKLINDPQEAERMG
Full Sequence
Protein Sequence     Length: 360     Download
MAKGATSKLN IAIIHPDLGI GGAERLIVDA AVELASQGHK VHVFTAHHDK NRCFEETVAD    60
QVSVVIPILK LKRSTKVVFY CHFPDLLLAQ HSTFIRRMYR KPIDLAEEIT TGMADLILVN    120
SKFTASTFAN TFKYLDAKGI RPAVLYPAVN VDQFNEPSSF KLNFLSINRF ERKKNIQLAI    180
SAFAMLNSPE GVLKHKDITN ASLTIAGGFD KRLKENVEYL EELKDLAEKE GVSNKIRFIT    240
SCSTAERNEL LSECLCVLYT PKDEHFGIVP LEAMAAYKPV IACNSGGPVE SIKNGVTGFL    300
CDPTPQEFSL AMAKLINDPQ EAERMGREAR RHVAESFSTK SFGQHLNRYL VDIHRGKED*    360
                                                                     420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG0438RfaG6.0e-368357400+
cd03798GT1_wlbH_like2.0e-369346396+
cd03811GT1_WabH_like1.0e-3710338372+
cd03801GT1_YqgM_like8.0e-4710338381+
cd03805GT1_ALG2_like8.0e-1799346399+
Gene Ontology
GO TermDescription
GO:0009058biosynthetic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAM26674.1013531396At1g78800/F9K20_16 [Arabidopsis thaliana]
GenBankACU21459.1013591407unknown [Glycine max]
RefSeqNP_178001.2013531396glycosyl transferase family 1 protein [Arabidopsis thaliana]
RefSeqXP_002317454.1083594413predicted protein [Populus trichocarpa]
RefSeqXP_002525620.1013591408alpha-1,3-mannosyltransferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2f9f_A8e-1715632413168A Chain A, Crystal Structure Of The Putative Mannosyl Transferase (Wbaz-1)from Archaeoglobus Fulgidus, Northeast Structural Genomics Target Gr29a
PDB3c4v_B0.0000000000012134722399A Chain A, Crystal Structure Of The Putative Mannosyl Transferase (Wbaz-1)from Archaeoglobus Fulgidus, Northeast Structural Genomics Target Gr29a
PDB3c4v_A0.0000000000012134722399A Chain A, Crystal Structure Of The Putative Mannosyl Transferase (Wbaz-1)from Archaeoglobus Fulgidus, Northeast Structural Genomics Target Gr29a
PDB3c4q_B0.0000000000012134722399A Chain A, Structure Of The Retaining Glycosyltransferase Msha : The First Step In Mycothiol Biosynthesis. Organism : Corynebacterium Glutamicum- Complex With Udp
PDB3c4q_A0.0000000000012134722399A Chain A, Structure Of The Retaining Glycosyltransferase Msha : The First Step In Mycothiol Biosynthesis. Organism : Corynebacterium Glutamicum- Complex With Udp
Metabolic Pathways
Pathway NameReactionECProtein Name
dolichyl-diphosphooligosaccharide biosynthesisRXN-5462EC-2.4.1.132GDP-Man:Man1GlcNAc2-PP-Dol α-1,3-mannosyltransferase
dolichyl-diphosphooligosaccharide biosynthesisRXN-5463EC-2.4.1.257GDP-Man:Man2GlcNAc2-PP-Dol α-1,6-mannosyltransferase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EG522343279543310
DR942573272893600
EV263639220432620
CV290429272813520
EV263639392552930.0000000001
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_021_00182.1Aquca_021_00182.2Aquca_021_00182.3
Arabidopsis lyrata477043
Arabidopsis thalianaAT1G78800.1
Brachypodium distachyonBradi5g19840.1
Brassica rapaBra035064
Carica papayaevm.model.supercontig_77.17
Capsella rubellaCarubv10022022m
Chlamydomonas reinhardtiig1920.t1
Citrus clementinaCiclev10022599mCiclev10020399m
Citrus sinensisorange1.1g036860m
Cucumis sativusCucsa.220170.2Cucsa.273740.2Cucsa.273740.1Cucsa.220170.1
Eucalyptus grandisEucgr.F01245.1
Fragaria vescamrna27271.1-v1.0-hybrid
Glycine maxGlyma12g35950.1Glyma13g34430.1Glyma13g34430.2
Gossypium raimondiiGorai.002G054000.2Gorai.002G054000.1
Linum usitatissimumLus10037008Lus10015797
Malus domesticaMDP0000319369MDP0000185482
Manihot esculentacassava4.1_008785m
Medicago truncatulaMedtr1g104880.1
Mimulus guttatusmgv1a007424m
Oryza sativaLOC_Os04g49960.1
Panicum virgatumPavirv00018845mPavirv00056995mPavirv00050038mPavirv00004378m
Physcomitrella patensPp1s246_77V6.1
Phaseolus vulgarisPhvul.005G081600.1
Picea abiesMA_499839g0010
Populus trichocarpaPotri.011G109000.1
Prunus persicappa006490mppa006502m
Ricinus communis29681.m001322
Setaria italicaSi017356mSi013830mSi010219m
Selaginella moellendorffii419620
Sorghum bicolorSb06g026860.1
Thellungiella halophilaThhalv10019736mThhalv10007837m
Vitis viniferaGSVIVT01014186001
Volvox carteriVocar20014584m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny