y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma13g01380.1
FamilyGH33
Protein PropertiesLength: 320 Molecular Weight: 35480.3 Isoelectric Point: 5.7186
ChromosomeChromosome/Scaffold: 13 Start: 1071152 End: 1074460
DescriptionBNR/Asp-box repeat family protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH33153092e-30
  FTYQAGSAPFKSCHASTIVEVDKDHFLVAYFGGTFEGAPDVKIWVQTYKNGRWQTPVIADEEPNVPMWNPALFKLPSDELLLFYKIGQEVQKWSGFIKRS
  YDKGKTWTEREQLPSGILGPIKNKPILLENGILLCGSSVESWNSCLGCVTTDFGRSWSKHGPIYIENEPLSVIQPVPYQTADGKLRVLLRSFDGIGRVCM
  SESSDGGKTWGYAKPTQLPNPNSGIDGVKLRDGQLLLAYNTVSRSVLKVALSKDDGDSWCEVLTLEDTSGMEFSYPAVIQDSDGRIHITYTYNRT
Full Sequence
Protein Sequence     Length: 320     Download
MASNCSIEGP LVEEFTYQAG SAPFKSCHAS TIVEVDKDHF LVAYFGGTFE GAPDVKIWVQ    60
TYKNGRWQTP VIADEEPNVP MWNPALFKLP SDELLLFYKI GQEVQKWSGF IKRSYDKGKT    120
WTEREQLPSG ILGPIKNKPI LLENGILLCG SSVESWNSCL GCVTTDFGRS WSKHGPIYIE    180
NEPLSVIQPV PYQTADGKLR VLLRSFDGIG RVCMSESSDG GKTWGYAKPT QLPNPNSGID    240
GVKLRDGQLL LAYNTVSRSV LKVALSKDDG DSWCEVLTLE DTSGMEFSYP AVIQDSDGRI    300
HITYTYNRTQ IKHVVLRPS*                                                360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG4692COG46921.0e-3323318351+
pfam13088BNR_23.0e-9338302283+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACU18568.10131934354unknown [Glycine max]
RefSeqNP_001154784.101131710318BNR/Asp-box repeat family protein [Arabidopsis thaliana]
RefSeqXP_002263578.10731755367PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002324495.1013191321predicted protein [Populus trichocarpa]
RefSeqXP_002531744.1013191321conserved hypothetical protein [Ricinus communis]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FG81262824412420
EL689016287193030
DV137355268403050
ES962106261322900
EY114510258102650
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_027_00263.5Aquca_027_00263.1Aquca_027_00263.2Aquca_027_00263.3Aquca_027_00263.4
Arabidopsis lyrata495867
Arabidopsis thalianaAT5G57700.1AT5G57700.2AT5G57700.3AT5G57700.4
Brachypodium distachyonBradi1g26287.2Bradi1g26287.4Bradi1g26287.1Bradi1g26287.3
Brassica rapaBra006806
Capsella rubellaCarubv10028058m
Citrus clementinaCiclev10008429m
Citrus sinensisorange1.1g020796m
Cucumis sativusCucsa.063760.7Cucsa.063760.5Cucsa.063760.1
Eucalyptus grandisEucgr.C02440.3Eucgr.C02440.2Eucgr.C02440.1
Fragaria vescamrna29636.1-v1.0-hybrid
Glycine maxGlyma13g01390.2Glyma17g07500.2Glyma17g07500.3Glyma17g07500.1
Gossypium raimondiiGorai.010G053100.8Gorai.010G053100.9Gorai.010G053100.6Gorai.012G095700.1Gorai.010G053100.5
Gorai.010G053100.4Gorai.010G053100.3Gorai.010G053100.2Gorai.010G053100.10Gorai.010G053100.1
Linum usitatissimumLus10008903
Malus domesticaMDP0000155009
Manihot esculentacassava4.1_011952m
Medicago truncatulaMedtr4g129200.1Medtr4g129180.1
Mimulus guttatusmgv1a018339m
Oryza sativaLOC_Os07g33220.1LOC_Os07g33224.1
Panicum virgatumPavirv00000088mPavirv00019697mPavirv00063023mPavirv00001202mPavirv00001203m
Pavirv00068158mPavirv00059537m
Physcomitrella patensPp1s96_140V6.2
Phaseolus vulgarisPhvul.003G150200.1Phvul.003G150000.2Phvul.003G150000.1Phvul.003G150000.4Phvul.003G150000.5
Phvul.003G150000.3Phvul.003G150000.6
Picea abiesMA_10435121g0010
Populus trichocarpaPotri.018G097100.1
Prunus persicappa020159m
Ricinus communis29749.m000140
Setaria italicaSi030500mSi030939mSi030026mSi029094m
Selaginella moellendorffii84263
Sorghum bicolorSb02g034675.1Sb02g034680.1
Thellungiella halophilaThhalv10013983m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny