y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma13g01500.1
FamilyGT22
Protein PropertiesLength: 537 Molecular Weight: 61743.2 Isoelectric Point: 9.3293
ChromosomeChromosome/Scaffold: 13 Start: 1208279 End: 1211532
DescriptionAlg9-like mannosyltransferase family
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT22394430
  FALCLAFRMVNSVLVQTYFNPDEHWQGPEIAHRIAFGYGHLTWEWKQGIRSYLHPIIFVPLYRLLALLHLDTPWLMMRAPRLLQSVFSAVGDLYLYKLAA
  VLFGDSVAKWTLFSQLSNWFMFYCFSRTLSNSLETVLTLVSLYFWPCMRPSSNCSFVSRKWGLAVAAVACAIRPTSAITWLYVGLLELFKAHDRFKFIFL
  EVAPIGILVLGLTCLLDRFMYGTWILVPLNFLKFNFLSAGGDYYGTHKWHWYFTQGFPVMIFSHLPFCIAGIIYSKQWKFSGLLAWVLGFYSLLGHKEFR
  FALPVLPIALMFSGYSLAVIEDPGYAQNKGKKSIKKHTRFPPNMGAAILFLLATNIPMALYMSLVHQRGPEDAMNHLAREALHGKVKSILFLTPCHATPY
  YSMLH
Full Sequence
Protein Sequence     Length: 537     Download
MRRRHNSDKY ADKEESQAPT SSKSDSDHTS FLCSQKRVFA LCLAFRMVNS VLVQTYFNPD    60
EHWQGPEIAH RIAFGYGHLT WEWKQGIRSY LHPIIFVPLY RLLALLHLDT PWLMMRAPRL    120
LQSVFSAVGD LYLYKLAAVL FGDSVAKWTL FSQLSNWFMF YCFSRTLSNS LETVLTLVSL    180
YFWPCMRPSS NCSFVSRKWG LAVAAVACAI RPTSAITWLY VGLLELFKAH DRFKFIFLEV    240
APIGILVLGL TCLLDRFMYG TWILVPLNFL KFNFLSAGGD YYGTHKWHWY FTQGFPVMIF    300
SHLPFCIAGI IYSKQWKFSG LLAWVLGFYS LLGHKEFRFA LPVLPIALMF SGYSLAVIED    360
PGYAQNKGKK SIKKHTRFPP NMGAAILFLL ATNIPMALYM SLVHQRGPED AMNHLAREAL    420
HGKVKSILFL TPCHATPYYS MLHHNLPMQF LDCTPSEEKG VPDESDRFLM DPIPFVSEYA    480
KNKSLPSHVV LFDSEEQKLK NLLISLDYKE EKRFFNAHFK VDRDLQGSIV VYVRIR*       540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03901Glyco_transf_223.0e-11337443427+
PLN02816PLN0281601533540+
Gene Ontology
GO TermDescription
GO:0006506GPI anchor biosynthetic process
GO:0016757transferase activity, transferring glycosyl groups
GO:0031227intrinsic to endoplasmic reticulum membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN70801.10425323494hypothetical protein [Vitis vinifera]
EMBLCBI36602.101253397622unnamed protein product [Vitis vinifera]
RefSeqNP_568305.1015333542mannosyltransferase, putative [Arabidopsis thaliana]
RefSeqXP_002271446.1015321536PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002513232.1015321533glycosyltransferase, putative [Ricinus communis]
Transmembrane Domains
StartEnd
120142
157179
199221
236253
260279
289311
318334
339358
378400
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7914053001814800
CO9796582382885250
HO413864518495300
GO8453593531564950
BU96480517311730
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_016_00400.3Aquca_016_00400.1Aquca_016_00400.2
Arabidopsis lyrata861876
Arabidopsis thalianaAT5G14850.1AT5G14850.2
Brachypodium distachyonBradi3g01150.1
Brassica rapaBra023489
Carica papayaevm.model.supercontig_42.125
Capsella rubellaCarubv10000649m
Citrus clementinaCiclev10007971m
Citrus sinensisorange1.1g009445morange1.1g010488m
Cucumis sativusCucsa.351020.4Cucsa.351020.2Cucsa.351020.1Cucsa.351020.3
Eucalyptus grandisEucgr.C00228.1
Fragaria vescamrna04987.1-v1.0-hybrid
Glycine maxGlyma17g07620.2
Gossypium raimondiiGorai.010G092100.8Gorai.010G092100.1Gorai.010G092100.7Gorai.010G092100.6Gorai.010G092100.4
Gorai.010G092100.3Gorai.010G092100.2Gorai.010G092100.5
Linum usitatissimumLus10033341Lus10033296Lus10034759
Manihot esculentacassava4.1_005070m
Medicago truncatulaMedtr4g129500.1
Mimulus guttatusmgv1a004248m
Oryza sativaLOC_Os01g39810.4LOC_Os01g39810.3LOC_Os01g39810.2LOC_Os01g39810.1LOC_Os02g02110.1
Panicum virgatumPavirv00059707mPavirv00064501m
Physcomitrella patensPp1s32_143V6.1
Phaseolus vulgarisPhvul.003G151000.1
Picea abiesMA_10430738g0010
Populus trichocarpaPotri.018G098700.3Potri.018G098700.1Potri.018G098700.2
Prunus persicappa003843m
Ricinus communis30225.m001678
Setaria italicaSi016829m
Selaginella moellendorffii105923
Sorghum bicolorSb09g025250.1
Thellungiella halophilaThhalv10013155m
Vitis viniferaGSVIVT01023723001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny