y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma13g01690.1
FamilyGT1
Protein PropertiesLength: 486 Molecular Weight: 54367.2 Isoelectric Point: 4.7987
ChromosomeChromosome/Scaffold: 13 Start: 1343941 End: 1346280
DescriptionUDP-glucosyl transferase 85A2
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT12794551.7e-38
  EESECVEWLDTKEPNSVVYVNFGSIAVMTSEQLIEFAWGLANSNKTFLWVIRPDLVAGENALLPSEFVKQTEKRGLLSSWCSQEQVLTHPAIGGFLTHSG
  WNSTLESVCGGVPMICWPFFAEQQTNCWFCCKEWGIGLEIEDVERDKIESLVRELMDGEKGKEMKEKALQWKELAKS
Full Sequence
Protein Sequence     Length: 486     Download
MGSLGTINNK PHAVCIPYPA QGHINPMLKL AKLLHFKGFH ITFVNTEYNH KRLLKARGPD    60
SLNGLSSFRF ETIPDGLPET DLDATQDIPS LCEATRRTCS PHFKNLLTKI NNSDAPPVSC    120
IVSDGVMSFT LDAAEELGLP EVLFWTTSAC GFMCYVQYEQ LIEKGLTPLK DSSYITNGYL    180
ETTIDWIPGI KEIRLKDLPS FIRTTNPDEF MLDFIQWECG RTRRASAIIL NTFDALEHDV    240
LEAFSSILPP VYSIGPLNLL VKHVDDKDLN AIGSNLWKEE SECVEWLDTK EPNSVVYVNF    300
GSIAVMTSEQ LIEFAWGLAN SNKTFLWVIR PDLVAGENAL LPSEFVKQTE KRGLLSSWCS    360
QEQVLTHPAI GGFLTHSGWN STLESVCGGV PMICWPFFAE QQTNCWFCCK EWGIGLEIED    420
VERDKIESLV RELMDGEKGK EMKEKALQWK ELAKSAAFGP VGSSFANLDN MVRDVLLGKN    480
VKYSY*                                                               540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02534PLN025342.0e-606404421+
PLN02173PLN021731.0e-6612475479+
PLN02448PLN024487.0e-8412479482+
PLN02410PLN024105.0e-8914472464+
PLN02555PLN025555.0e-9011482488+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACJ84649.1014771479unknown [Medicago truncatula]
DDBJBAB86928.10104809480glucosyltransferase-10 [Vigna angularis]
DDBJBAG80542.1014811483glycosyltransferase [Lycium barbarum]
RefSeqXP_002302305.1014771479predicted protein [Populus trichocarpa]
RefSeqXP_002513938.10104779478UDP-glucuronosyltransferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2pq6_A014801482A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vg8_A084534446A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vch_A084534446A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vce_A084534446A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2c9z_A044811456A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
Metabolic Pathways
Pathway NameReactionECProtein Name
cytokinins-O-glucoside biosynthesisRXN-4723EC-2.4.1.203trans-zeatin O-β-D-glucosyltransferase
cytokinins-O-glucoside biosynthesisRXN-4726EC-2.4.1UDP-glucose:dihydrozeatin O-β-D-glucosyltransferase
cytokinins-O-glucoside biosynthesisRXN-4735EC-2.4.1.215cis-zeatin O-β-D-glucosyltransferase
cytokinins-O-glucoside biosynthesisRXN-4737EC-2.4.1dihydrozeatin-9-N-glucoside O-β-D-glucosyltransferase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO797374363694310
EG63125448374800
HO782675310413500
HO782675303553840.000000004
HO782675123823930.000000004
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_050_00022.1Aquca_010_00166.1Aquca_010_00171.1Aquca_016_00020.1Aquca_010_00173.1
Aquca_016_00023.1Aquca_057_00092.1Aquca_028_00117.1Aquca_012_00168.1Aquca_028_00116.1
Aquca_033_00125.1Aquca_008_00276.1Aquca_010_00165.1Aquca_010_00172.1Aquca_039_00125.1
Aquca_093_00001.2Aquca_093_00001.1Aquca_016_00021.1Aquca_028_00265.1Aquca_039_00119.1
Aquca_012_00129.1Aquca_104_00008.1Aquca_028_00113.1Aquca_012_00237.1Aquca_012_00022.1
Aquca_028_00114.1Aquca_039_00120.1Aquca_010_00170.1Aquca_006_00132.1
Arabidopsis lyrata472480319356313123881781313121
335478472476472478476994
Arabidopsis thalianaAT1G22380.1AT1G22340.1AT1G78270.1AT1G22400.1AT1G22360.1
AT1G22370.1AT1G22370.2AT1G22360.2
Brachypodium distachyonBradi3g58700.1Bradi3g58680.1Bradi3g58670.1Bradi3g46855.1Bradi1g20190.1
Bradi5g11950.1Bradi5g06377.1Bradi3g46557.1Bradi3g46870.1Bradi5g08895.1
Bradi4g23757.1Bradi5g11230.1Bradi3g46547.1Bradi1g45567.1Bradi3g15935.1
Brassica rapaBra012322Bra031386Bra012323Bra031387Bra012324
Bra016382Bra031388Bra008354
Carica papayaevm.model.supercontig_36.150evm.model.supercontig_36.153evm.TU.contig_32224.1evm.model.supercontig_85.124evm.model.supercontig_85.125
evm.model.supercontig_55.73
Capsella rubellaCarubv10008992mCarubv10011877mCarubv10011262mCarubv10011467mCarubv10011698m
Carubv10009316m
Citrus clementinaCiclev10025476mCiclev10025504mCiclev10001630mCiclev10000958mCiclev10004031m
Ciclev10000925mCiclev10011540mCiclev10013430mCiclev10011729m
Citrus sinensisorange1.1g022329morange1.1g022321morange1.1g022811morange1.1g012342morange1.1g012217m
orange1.1g010775morange1.1g010684morange1.1g010825morange1.1g047540morange1.1g037221m
Cucumis sativusCucsa.104310.1Cucsa.218040.1Cucsa.311540.1Cucsa.218050.1Cucsa.218060.1
Cucsa.345730.1Cucsa.218010.1Cucsa.345720.1Cucsa.218070.1Cucsa.291510.1
Cucsa.345740.3Cucsa.345740.2Cucsa.345740.1Cucsa.358270.1
Eucalyptus grandisEucgr.I02656.1Eucgr.J01276.1Eucgr.H04754.1Eucgr.H04764.1Eucgr.H04760.1
Eucgr.H04762.1Eucgr.H04759.1Eucgr.H04756.1Eucgr.H04766.1Eucgr.I00512.1
Eucgr.L02357.1Eucgr.L00508.1Eucgr.L00503.1Eucgr.L00504.1Eucgr.L00512.1
Eucgr.L00994.1Eucgr.F00343.1Eucgr.L00991.1Eucgr.F00339.1Eucgr.F00340.1
Eucgr.F00348.1Eucgr.F00338.1Eucgr.L00599.1Eucgr.B01109.1Eucgr.F03595.1
Eucgr.E01564.1Eucgr.F00353.1Eucgr.F00337.1Eucgr.G02220.1Eucgr.G02217.1
Eucgr.L00511.1Eucgr.I02647.1Eucgr.G03386.1Eucgr.G02216.2Eucgr.G02215.2
Eucgr.L00502.1Eucgr.G02216.1Eucgr.G02215.1Eucgr.F03599.1Eucgr.F03601.1
Eucgr.F03591.1Eucgr.F03596.1Eucgr.F00346.1Eucgr.F03592.1Eucgr.F00340.2
Eucgr.E01567.1Eucgr.E01562.1Eucgr.L02355.1Eucgr.F00351.1Eucgr.F00342.1
Eucgr.F00349.1Eucgr.A01595.1
Fragaria vescamrna34573.1-v1.0-hybridmrna34574.1-v1.0-hybrid
Glycine maxGlyma02g25930.1Glyma08g19000.1Glyma13g14190.1Glyma20g05700.1Glyma18g01950.2
Glyma15g05980.1Glyma19g04570.1Glyma19g04610.1Glyma15g06000.1Glyma15g37520.1
Glyma14g35270.1Glyma14g35220.1Glyma14g35190.1Glyma06g10733.1Glyma14g35160.1
Glyma15g05700.1Glyma02g35121.1
Gossypium raimondiiGorai.003G040100.1Gorai.013G060700.1Gorai.013G060500.1Gorai.013G060400.1Gorai.009G235700.1
Linum usitatissimumLus10025741Lus10000993Lus10024584Lus10041055Lus10035903
Lus10024583Lus10032220Lus10031388Lus10032218Lus10010943
Lus10010665Lus10007421Lus10013924Lus10019364Lus10013923
Lus10017542Lus10000632Lus10013920Lus10013919Lus10013925
Lus10013921Lus10013922Lus10039277
Malus domesticaMDP0000289413MDP0000124522MDP0000134572MDP0000213111MDP0000150485
MDP0000589403MDP0000780011MDP0000682471MDP0000879480MDP0000180882
MDP0000182819MDP0000683535MDP0000504599MDP0000259360MDP0000915151
MDP0000950422MDP0000154932MDP0000177468MDP0000185209MDP0000219696
MDP0000256195MDP0000213638MDP0000196677MDP0000246186MDP0000124585
MDP0000813186MDP0000292218MDP0000498524MDP0000552871MDP0000311467
MDP0000120322MDP0000188794MDP0000841540MDP0000200450MDP0000283230
MDP0000193401MDP0000150721MDP0000133911MDP0000156988MDP0000185273
MDP0000175678MDP0000159635MDP0000176595MDP0000508014MDP0000124584
MDP0000219950MDP0000194392MDP0000299860MDP0000212461
Manihot esculentacassava4.1_026422mcassava4.1_006558mcassava4.1_006561mcassava4.1_025925mcassava4.1_006353m
cassava4.1_029261mcassava4.1_013933mcassava4.1_006649mcassava4.1_005558mcassava4.1_021191m
cassava4.1_010735mcassava4.1_006654mcassava4.1_033520mcassava4.1_031484mcassava4.1_023166m
cassava4.1_025238mcassava4.1_030305mcassava4.1_028696m
Medicago truncatulaMedtr3g079480.1Medtr1g100520.1Medtr6g014270.1Medtr6g014050.1Medtr3g008010.1
Medtr6g014250.1Medtr6g014150.1Medtr6g014190.1Medtr6g013900.1Medtr6g014470.1
Medtr6g014310.1Medtr6g014240.1Medtr6g014170.1Medtr6g014187.1Medtr5g058320.1
Medtr6g014200.1Medtr5g064240.1Medtr6g014340.1Medtr6g014290.1Medtr7g011470.1
Medtr4g094220.1Medtr6g013920.1Medtr6g013990.1Medtr6g014040.1Medtr6g014220.1
Medtr6g014020.1Medtr6g014580.1Medtr6g013960.1Medtr8g043470.1Medtr4g033620.1
Medtr2g008210.1Medtr6g014300.1
Mimulus guttatusmgv1a025300mmgv1a005711mmgv1a005587mmgv1a024760mmgv1a005689m
mgv1a005383mmgv1a005662mmgv1a018722mmgv1a025645mmgv1a006002m
mgv1a021775mmgv1a023488m
Oryza sativaLOC_Os02g51910.1LOC_Os02g51900.1LOC_Os02g51930.1LOC_Os04g25380.1LOC_Os04g25970.1
LOC_Os02g36830.1LOC_Os04g25980.1LOC_Os04g37820.1LOC_Os02g36840.1LOC_Os08g31200.1
LOC_Os04g25440.1LOC_Os04g25370.1LOC_Os04g24850.1LOC_Os04g25800.1LOC_Os02g28900.1
LOC_Os04g25490.1LOC_Os02g36810.1LOC_Os08g07200.1LOC_Os06g11720.1
Panicum virgatumPavirv00012781mPavirv00030800mPavirv00023457mPavirv00017384mPavirv00001927m
Pavirv00067140mPavirv00008304mPavirv00003072mPavirv00022369mPavirv00048885m
Pavirv00003087mPavirv00035729mPavirv00047416mPavirv00008112mPavirv00016911m
Pavirv00052190mPavirv00002582mPavirv00043932mPavirv00048044mPavirv00064463m
Pavirv00051913mPavirv00006307mPavirv00044179mPavirv00040421mPavirv00023047m
Pavirv00027257mPavirv00039402mPavirv00057091mPavirv00051079mPavirv00052414m
Pavirv00037566mPavirv00023046mPavirv00055518mPavirv00048975m
Phaseolus vulgarisPhvul.006G017500.1Phvul.008G175500.1Phvul.004G043600.1Phvul.008G175300.1Phvul.006G017600.1
Phvul.008G174700.1Phvul.006G205600.1Phvul.004G043400.1Phvul.004G043200.1Phvul.004G042900.1
Phvul.006G205500.1Phvul.006G205700.1Phvul.004G043300.1Phvul.008G175600.1Phvul.004G043500.1
Phvul.006G017400.1Phvul.011G158500.1Phvul.004G043100.1Phvul.004G043000.1
Picea abiesMA_10436276g0020MA_167914g0010MA_167603g0010MA_22116g0010MA_10434089g0020
MA_224931g0010MA_10427096g0010MA_9514701g0010MA_10434089g0010MA_10284226g0010
MA_10172523g0010MA_10431252g0010.641.827MA_10431252g0010.641.827MA_281794g0010MA_167774g0010
MA_10426668g0010MA_10436413g0010MA_95435g0010MA_3747445g0010MA_9029785g0010
MA_207926g0010.80.201MA_207926g0010.80.201MA_158653g0010MA_86064g0010MA_10426668g0020
Populus trichocarpaPotri.005G073800.1Potri.007G095000.1Potri.001G313000.1Potri.016G021500.1Potri.016G022000.1
Potri.002G098300.1Potri.006G023600.1Potri.016G022100.1Potri.006G023100.3Potri.016G022400.2
Potri.016G022400.1Potri.004G172700.2Potri.004G172700.1Potri.006G022300.1Potri.006G023700.1
Potri.017G052300.1Potri.007G132400.1Potri.T148700.1Potri.006G023100.2Potri.006G023100.1
Potri.006G022800.1Potri.002G098400.1Potri.017G052400.1Potri.016G022500.1Potri.001G312600.1
Potri.T181000.1Potri.016G021000.1Potri.016G020800.2Potri.016G020800.1Potri.017G052000.2
Potri.017G052000.1Potri.006G022500.1Potri.016G021600.1Potri.016G021100.1Potri.006G022600.1
Potri.016G020400.1Potri.017G052100.2Potri.017G052100.1Potri.016G021200.1Potri.016G021700.1
Potri.016G021800.1Potri.016G020700.1Potri.016G020900.1Potri.016G020500.1Potri.016G021300.1
Potri.006G023000.1
Prunus persicappa018343mppa021414mppa017055mppa026557mppa015357m
ppa004968mppa005043mppa023851mppa021058mppa004909m
ppa004956mppa004979mppa020820mppa004945mppa004989m
ppa018697mppa019145mppb015490m
Ricinus communis27561.m00029628492.m00046630131.m00714627956.m00035029806.m000962
27956.m00035229806.m00096329806.m00096129806.m00096429806.m000960
27956.m00034929908.m00605029848.m00468829908.m00604829908.m006049
Setaria italicaSi017031mSi017045mSi009951mSi017055mSi017025m
Si009941mSi016991mSi028377mSi028384mSi009917m
Si016809mSi017086mSi017064mSi020070mSi029646m
Si006315mSi019905mSi015022m
Sorghum bicolorSb01g001220.1Sb06g018460.1Sb04g027420.1Sb04g027460.1Sb04g027470.1
Sb04g023920.1Sb04g023930.1Sb09g023700.1Sb06g018490.1Sb10g009800.1
Sb02g030370.1Sb10g025750.1Sb07g021090.1Sb04g023530.1Sb02g039670.1
Sb10g007700.1Sb07g004500.1
Thellungiella halophilaThhalv10007502mThhalv10007489mThhalv10009957m.282.458Thhalv10009957m.282.458Thhalv10007499m
Thhalv10009957m.570.750Thhalv10009957m.570.750Thhalv10019687m
Vitis viniferaGSVIVT01015729001GSVIVT01006626001GSVIVT01009052001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)