y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma13g02000.1
FamilyGH5
Protein PropertiesLength: 507 Molecular Weight: 57014.5 Isoelectric Point: 8.173
ChromosomeChromosome/Scaffold: 13 Start: 1827351 End: 1832253
Description
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH52174955.60519e-43
  QVMKEHWKTFIVEDDFKFIASNGLNAVRIPIGWWIASDPTPPPPYVGGSLNALDKAFLWAQKYGLKIILDLHAAPGSQNGFEHSSSRDGSQEWGKTDETI
  QQTVHVIDFLTARYAKCQSLYAVELINEPLSPGVTLEALNKYYKAGYEAVRKHSSTAYVVLSNRIGPSNPRELFPLANGLMRSVIDVHYYNLFQDVFNDM
  TVQQNIDFIYNNRSSQLSFVTTSNGPLTFVGEWVAEWQVNGATKEDYQRFAKAQLDVYGRATFGWAYWAFKNVNNHWSL
Full Sequence
Protein Sequence     Length: 507     Download
MMTSYVNLKI WLLNFVTLFS ILSLSHGRRA NANFRVRAVN LGGWLVTEGW MKPSLFDGIP    60
NKDFLDGTGL QFKSVTTRKY LCAESGGGTI IVANRTSASG WETFALWRLN EDTFRFRVFN    120
KQFVGLDGIN VVAVSNISTD SLTFHVVKES DNSNRVRIKA SNGYFLQAKT EDLVTADGSE    180
VNGWGDDDPS VFVMTIGKRM QGEYQVTSGY GPTKAHQVMK EHWKTFIVED DFKFIASNGL    240
NAVRIPIGWW IASDPTPPPP YVGGSLNALD KAFLWAQKYG LKIILDLHAA PGSQNGFEHS    300
SSRDGSQEWG KTDETIQQTV HVIDFLTARY AKCQSLYAVE LINEPLSPGV TLEALNKYYK    360
AGYEAVRKHS STAYVVLSNR IGPSNPRELF PLANGLMRSV IDVHYYNLFQ DVFNDMTVQQ    420
NIDFIYNNRS SQLSFVTTSN GPLTFVGEWV AEWQVNGATK EDYQRFAKAQ LDVYGRATFG    480
WAYWAFKNVN NHWSLEWMVK NGYIKL*                                        540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam06268Fascin0.00779182107+
cd00257Fascin8.0e-772184113+
pfam00150Cellulase2.0e-11222488277+
COG2730BglC2.0e-28211503331+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI18831.1025061505unnamed protein product [Vitis vinifera]
EMBLCBI33033.101850615505unnamed protein product [Vitis vinifera]
RefSeqNP_001064458.102050616508Os10g0370500 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002285806.1025061508PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002513884.10125069506conserved hypothetical protein [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3n9k_A1e-3520350250381A Chain A, F229aE292S DOUBLE MUTANT OF EXO-Beta-1,3-Glucanase From Candida Albicans In Complex With Laminaritriose At 1.7 A
PDB2pc8_A1e-3520350251382A Chain A, E292q Mutant Of Exo-B-(1,3)-Glucanase From Candida Albicans In Complex With Two Separately Bound Glucopyranoside Units At 1.8 A
PDB1eqp_A1e-3520350245376A Chain A, Exo-B-(1,3)-Glucanase From Candida Albicans
Transmembrane Domains
StartEnd
527
Signal Peptide
Cleavage Site
27
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DC8989053791285060
GO266806281883680
DC8992993191885060
JG5647013031904920
FF3913432492364830
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_010_00111.1Aquca_010_00110.1
Brachypodium distachyonBradi2g31690.1Bradi3g38500.1
Carica papayaevm.model.supercontig_55.63evm.model.supercontig_66.87evm.model.supercontig_20.222
Citrus clementinaCiclev10025463mCiclev10026955mCiclev10025415mCiclev10000913m
Citrus sinensisorange1.1g009560morange1.1g046395morange1.1g019395morange1.1g013777morange1.1g010600m
orange1.1g009475m
Cucumis sativusCucsa.104180.2Cucsa.104180.1
Eucalyptus grandisEucgr.I00417.1Eucgr.L01170.1Eucgr.L02139.1Eucgr.I00543.1Eucgr.I00415.1
Eucgr.F00486.1Eucgr.F00489.1Eucgr.F00489.3Eucgr.F00489.2Eucgr.F00487.1
Eucgr.L01169.1Eucgr.F00488.1Eucgr.I00415.2
Fragaria vescamrna16220.1-v1.0-hybridmrna16368.1-v1.0-hybridmrna22085.1-v1.0-hybridmrna16374.1-v1.0-hybrid
Glycine maxGlyma11g37881.1Glyma18g01781.2Glyma18g01781.3Glyma18g01781.1Glyma06g47761.6
Glyma06g47761.1Glyma06g47761.5Glyma06g47761.2Glyma06g47761.8Glyma06g47761.4
Glyma06g47761.7Glyma06g47761.3Glyma13g02030.2Glyma06g47750.1Glyma08g14676.1
Glyma05g31460.1Glyma14g34450.1
Gossypium raimondiiGorai.009G239600.6Gorai.009G239600.5Gorai.009G239600.4Gorai.009G239600.1Gorai.009G239600.3
Gorai.009G239600.2Gorai.009G239600.7Gorai.011G110800.2Gorai.011G110800.1Gorai.003G041900.1
Gorai.003G044300.1Gorai.003G044000.4Gorai.003G044000.5Gorai.003G044200.1Gorai.003G044000.3
Gorai.003G044000.2Gorai.003G044000.1
Linum usitatissimumLus10041110Lus10036436
Malus domesticaMDP0000319015MDP0000123200MDP0000133367
Manihot esculentacassava4.1_007845mcassava4.1_026104mcassava4.1_006238m
Medicago truncatulaMedtr3g009020.1Medtr3g086750.1Medtr3g009030.1Medtr5g062290.1Medtr3g008960.1
Medtr5g062190.1Medtr3g009010.1Medtr8g091310.1
Mimulus guttatusmgv1a004896mmgv1a019918m
Oryza sativaLOC_Os10g22570.1.193.483LOC_Os10g22570.1.193.483LOC_Os10g22570.1.193.483LOC_Os10g22520.1LOC_Os10g22570.1.671.954
LOC_Os10g22570.1.671.954LOC_Os10g22570.1.671.954LOC_Os05g15510.2LOC_Os05g15510.1LOC_Os08g37750.1
Panicum virgatumPavirv00046245mPavirv00011301mPavirv00018291mPavirv00046244mPavirv00011300m
Pavirv00028658mPavirv00000970mPavirv00042459mPavirv00046564m
Physcomitrella patensPp1s304_43V6.1
Phaseolus vulgarisPhvul.001G254400.1Phvul.008G171300.1Phvul.002G261800.1Phvul.008G171400.1
Picea abiesMA_10427061g0010MA_479818g0010MA_4911g0010MA_14445g0010MA_23595g0010
Populus trichocarpaPotri.007G010000.1Potri.005G167800.1Potri.007G089400.1Potri.007G089400.2Potri.005G078500.1
Potri.002G093000.1
Prunus persicappa023601mppa005425mppa019648m
Ricinus communis29810.m00014529908.m00599427889.m00017327905.m00007336339.m000016
Setaria italicaSi035257mSi006205mSi021695mSi021671mSi039329m
Si013558mSi035337m
Selaginella moellendorffii12682742658240418324801
Sorghum bicolorSb10g007500.1Sb09g008170.1Sb01g024390.1Sb10g008480.1
Vitis viniferaGSVIVT01003438001GSVIVT01006372001GSVIVT01006369001GSVIVT01002801001GSVIVT01008995001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)