y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma13g02030.2
FamilyGH5
Protein PropertiesLength: 488 Molecular Weight: 54966.3 Isoelectric Point: 8.0571
ChromosomeChromosome/Scaffold: 13 Start: 1841452 End: 1847196
Description
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH51984724.30058e-42
  MKEHWSTFIVENDFKFIASNGLNAARIPVGWWIASDPNPPWPYVGGSLHALDNAFLWAQKYGLKIIIDLHAAPGSQNGFQHGGSRDGSQEWGKTNKNILQ
  TVRVIEFLTARYAKRPSFYAVELLNEPLSPGVTLEMLNKYYKAGYDAVRRHSPTAFVVLSNRIGPSKPKELFPLANGLMRSVIDVHYYNIFDDVFENMSA
  QQNIDFIYTNRSSQLNNITTSNGNGPLTFVGEWVADWRVKNATKEDFQRFAKAQLDVFGRATFGWAYWALKNANK
Full Sequence
Protein Sequence     Length: 488     Download
MVSLSHGRLN AQFQVKAVNL GGWLVTEGWM KPSLFDGIPN KDFLDGTGLQ FKSVMTGKYL    60
CAESGGGTIL VANCTDASGW ETFRLWRINE DTFRLRVFNK QFVGLDGINV VAVSNICTYS    120
ETFHIVKESD NSSRIRIKAS NGYFLQAKTQ ELVTADVSEV REWEDDDPTI FVMTIAARLQ    180
GEFQVTNGYG PTKAPQVMKE HWSTFIVEND FKFIASNGLN AARIPVGWWI ASDPNPPWPY    240
VGGSLHALDN AFLWAQKYGL KIIIDLHAAP GSQNGFQHGG SRDGSQEWGK TNKNILQTVR    300
VIEFLTARYA KRPSFYAVEL LNEPLSPGVT LEMLNKYYKA GYDAVRRHSP TAFVVLSNRI    360
GPSKPKELFP LANGLMRSVI DVHYYNIFDD VFENMSAQQN IDFIYTNRSS QLNNITTSNG    420
NGPLTFVGEW VADWRVKNAT KEDFQRFAKA QLDVFGRATF GWAYWALKNA NKYWNLEWMI    480
ENGYVKI*                                                             540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00257Fascin3.0e-651164114+
pfam00150Cellulase1.0e-10201471278+
COG2730BglC5.0e-27190484331+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI18831.101548735505unnamed protein product [Vitis vinifera]
EMBLCBI33033.101548735505unnamed protein product [Vitis vinifera]
RefSeqNP_001064458.101548738508Os10g0370500 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002285806.10148720508PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002513884.10148718506conserved hypothetical protein [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1eqp_A7e-3218248345376A Chain A, Exo-B-(1,3)-Glucanase From Candida Albicans
PDB1eqc_A1e-3118248345376A Chain A, Exo-B-(1,3)-Glucanase From Candida Albicans
PDB1cz1_A1e-3118248345376A Chain A, Exo-B-(1,3)-Glucanase From Candida Albicans At 1.85 A Resolution
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DC8989053811074870
FS330569262102710
GO266806281673470
JG5647013011694690
EL450599308163210
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_010_00111.1Aquca_010_00110.1
Brachypodium distachyonBradi2g31690.1Bradi3g38500.1
Carica papayaevm.model.supercontig_55.63evm.model.supercontig_66.87evm.model.supercontig_20.222
Citrus clementinaCiclev10025463mCiclev10026955mCiclev10025415mCiclev10000913m
Citrus sinensisorange1.1g009560morange1.1g046395morange1.1g019395morange1.1g013777morange1.1g010600m
orange1.1g009475m
Cucumis sativusCucsa.104180.2Cucsa.104180.1
Eucalyptus grandisEucgr.I00417.1Eucgr.L01170.1Eucgr.L02139.1Eucgr.I00543.1Eucgr.I00415.1
Eucgr.F00486.1Eucgr.F00489.1Eucgr.F00489.3Eucgr.F00489.2Eucgr.F00487.1
Eucgr.L01169.1Eucgr.F00488.1Eucgr.I00415.2
Fragaria vescamrna16220.1-v1.0-hybridmrna16368.1-v1.0-hybridmrna22085.1-v1.0-hybridmrna16374.1-v1.0-hybrid
Glycine maxGlyma11g37881.1Glyma18g01781.2Glyma18g01781.3Glyma18g01781.1Glyma06g47761.6
Glyma06g47761.1Glyma06g47761.5Glyma06g47761.2Glyma06g47761.8Glyma06g47761.4
Glyma06g47761.7Glyma06g47761.3Glyma06g47750.1Glyma13g02000.1Glyma08g14676.1
Glyma05g31460.1Glyma14g34450.1
Gossypium raimondiiGorai.009G239600.6Gorai.009G239600.5Gorai.009G239600.4Gorai.009G239600.1Gorai.009G239600.3
Gorai.009G239600.2Gorai.009G239600.7Gorai.011G110800.2Gorai.011G110800.1Gorai.003G041900.1
Gorai.003G044300.1Gorai.003G044000.4Gorai.003G044000.5Gorai.003G044200.1Gorai.003G044000.3
Gorai.003G044000.2Gorai.003G044000.1
Linum usitatissimumLus10041110Lus10036436
Malus domesticaMDP0000319015MDP0000123200MDP0000133367
Manihot esculentacassava4.1_007845mcassava4.1_026104mcassava4.1_006238m
Medicago truncatulaMedtr3g009020.1Medtr3g086750.1Medtr3g009030.1Medtr5g062290.1Medtr3g008960.1
Medtr5g062190.1Medtr3g009010.1Medtr8g091310.1
Mimulus guttatusmgv1a004896mmgv1a019918m
Oryza sativaLOC_Os10g22570.1.193.483LOC_Os10g22570.1.193.483LOC_Os10g22570.1.193.483LOC_Os10g22520.1LOC_Os10g22570.1.671.954
LOC_Os10g22570.1.671.954LOC_Os10g22570.1.671.954LOC_Os05g15510.2LOC_Os05g15510.1LOC_Os08g37750.1
Panicum virgatumPavirv00046245mPavirv00011301mPavirv00018291mPavirv00046244mPavirv00011300m
Pavirv00028658mPavirv00000970mPavirv00042459mPavirv00046564m
Physcomitrella patensPp1s304_43V6.1
Phaseolus vulgarisPhvul.001G254400.1Phvul.008G171300.1Phvul.002G261800.1Phvul.008G171400.1
Picea abiesMA_10427061g0010MA_479818g0010MA_4911g0010MA_14445g0010MA_23595g0010
Populus trichocarpaPotri.007G010000.1Potri.005G167800.1Potri.007G089400.1Potri.007G089400.2Potri.005G078500.1
Potri.002G093000.1
Prunus persicappa023601mppa005425mppa019648m
Ricinus communis29810.m00014529908.m00599427889.m00017327905.m00007336339.m000016
Setaria italicaSi035257mSi006205mSi021695mSi021671mSi039329m
Si013558mSi035337m
Selaginella moellendorffii12682742658240418324801
Sorghum bicolorSb10g007500.1Sb09g008170.1Sb01g024390.1Sb10g008480.1
Vitis viniferaGSVIVT01003438001GSVIVT01006372001GSVIVT01006369001GSVIVT01002801001GSVIVT01008995001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)