y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma13g04761.1
FamilyGH38
Protein PropertiesLength: 1156 Molecular Weight: 132083 Isoelectric Point: 7.3836
ChromosomeChromosome/Scaffold: 13 Start: 5018977 End: 5026202
Descriptiongolgi alpha-mannosidase II
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH381444830
  KVFVVPHSHNDPGWKLTVDEYYDRQSRHILDTIVQTLTKDFRRKFIWEEMSYLERWWRDASDEMKESFINLVKNGQLEIVGGGWVMNDEANSHYFAIIEQ
  IAEGNMWLNDTIGFVPKNSWAIDPFGYSSTMAYLLRRMGFDNMLIQRTHYELKKELAWHKNLEYIWRQSWDAEETTDIFVHMMPFYSYDIPHTCGPEPAI
  CCQFDFARMSGFAYEQCPWGQYPVETTQENVQERALKLLDQYKKKSTLYRTNTLLVPLGDDFRYINVEEAEAQFRNYQMLFDYINSNPSLNAEAKFGTLE
  DYFVTLREEAERINYSSPGEIGSGLVEGFPSLSGDFFTYA
Full Sequence
Protein Sequence     Length: 1156     Download
MPFSSSRRGT SWASSILPSS NPPKSKAPRK GRKRALVKDF IFSNFFAIGL VLSLSLFLLI    60
LLRFGVPKPL STHFRTTTRS SRARHTRKPL PAGTNRSTLA GAAVDVTTKA LYDKIEFLDV    120
DGGAWKQGWS VTYRGNEWDS EKLKVFVVPH SHNDPGWKLT VDEYYDRQSR HILDTIVQTL    180
TKDFRRKFIW EEMSYLERWW RDASDEMKES FINLVKNGQL EIVGGGWVMN DEANSHYFAI    240
IEQIAEGNMW LNDTIGFVPK NSWAIDPFGY SSTMAYLLRR MGFDNMLIQR THYELKKELA    300
WHKNLEYIWR QSWDAEETTD IFVHMMPFYS YDIPHTCGPE PAICCQFDFA RMSGFAYEQC    360
PWGQYPVETT QENVQERALK LLDQYKKKST LYRTNTLLVP LGDDFRYINV EEAEAQFRNY    420
QMLFDYINSN PSLNAEAKFG TLEDYFVTLR EEAERINYSS PGEIGSGLVE GFPSLSGDFF    480
TYADRQQDYW SGYYVSRPFF KAVDRVLEQT LRATEMMVAL ILGTCWRSHC EKFAMGFSYK    540
LTAARRNLAL FQHHDGVTGT AKDHVVMDYG MRMHTSLLDL QIFMSKAAEA LLGIRFDKLD    600
HSPAQFEPAI VRSKYDAQPL HKVISVHEGS YESVVFFNPL EQTREEVVMV VVDSPDVTVV    660
DSSWTCVQSQ ILPELQYHSS KIFTGKHRLY WKVSVPAMGL ETYYISNSFA QCEKARPAKL    720
KIFSKSSSVA CPTPYSCVKI EADVAEIENE HQKLIFDVKY GLLQKIISEN SSPNTVNEEI    780
GMYSSSGGAY LFKPHGDAQS IIEEGGQLLV SEGPLMQEVY SYPRTAWEKS PISHSTRIYS    840
GESTVQGFAI EKEYHVELLG HDFNDRELIV RYKTDIDNKK IFYSDLNGFQ MSRRETYDKI    900
PLQGNYYPMP YLAFIQGSNG RRFSVHSRQS LGVTSLKNGW LEIMVDRRLV RDDGRGLGQG    960
VMDNRVMNVV FHLTVEANVS ATSNLVPTPF PYSPSLLSHR VGSHLNYPIH AFVSKKPQDM    1020
SMKPPPRSFS PLAAPLPCDL HIVNFKVPKP LKFLQQPPEG PRFGLILHRR HWDSSYCQKG    1080
RSQCTNLANG TMNLFSMFKN LTVSKAKATS LNLLHEDPEV MGFSEQFGDL AQEGHVAISP    1140
MEIQAYKLEL RPQPQ*                                                    1200
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00451GH38N_AMII_euk1.0e-107143429288+
cd11667GH38N_Man2A23.0e-149143494352+
cd11666GH38N_Man2A18.0e-154143494352+
PLN02701PLN02701010411511051+
cd10809GH38N_AMII_GMII_SfManIII_like0142494353+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0004559alpha-mannosidase activity
GO:0005975carbohydrate metabolic process
GO:0006013mannose metabolic process
GO:0008270zinc ion binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI35021.101115211056unnamed protein product [Vitis vinifera]
RefSeqNP_196999.101115311172GMII (GOLGI ALPHA-MANNOSIDASE II); alpha-mannosidase [Arabidopsis thaliana]
RefSeqXP_002276468.101115211149PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002438145.10581152711178hypothetical protein SORBIDRAFT_10g008770 [Sorghum bicolor]
RefSeqXP_002517418.1041153211179mannosidase alpha class 2a, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ps3_A086101323933A Chain A, Golgi Alpha-mannosidase Ii In Complex With Kifunensine
PDB3eju_A086101323933A Chain A, Golgi Alpha-mannosidase Ii In Complex With Kifunensine
PDB3ejt_A086101323933A Chain A, Golgi Alpha-mannosidase Ii In Complex With Kifunensine
PDB3ejs_A086101323933A Chain A, Golgi Alpha-mannosidase Ii In Complex With Kifunensine
PDB3ejr_A086101323933A Chain A, Golgi Alpha-mannosidase Ii In Complex With Kifunensine
Transmembrane Domains
StartEnd
4062
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7891222731484200
FL7143862732305020
EH26119425386811200
CB6620862812745540
GR3180372661043690
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_00345.1.265.483Aquca_002_00345.1.265.483Aquca_006_00230.1Aquca_006_00257.5Aquca_006_00257.9
Aquca_006_00257.8Aquca_006_00257.7Aquca_006_00257.6Aquca_006_00257.4Aquca_006_00257.3
Aquca_006_00257.2Aquca_006_00257.1Aquca_043_00016.7Aquca_043_00016.8Aquca_043_00016.6
Aquca_043_00016.5Aquca_043_00016.4Aquca_043_00016.3Aquca_043_00016.2Aquca_043_00016.1
Aquca_043_00019.2Aquca_043_00019.1Aquca_043_00018.1Aquca_056_00071.1Aquca_002_00345.1.162.261
Aquca_002_00345.1.162.261
Arabidopsis lyrata488339488225497001484445
Arabidopsis thalianaAT5G14950.1AT5G66150.1AT5G13980.3AT5G13980.2AT5G13980.1
AT3G26720.2AT3G26720.1
Brachypodium distachyonBradi1g44550.1Bradi3g21117.1Bradi4g17327.1Bradi4g17317.1
Brassica rapaBra023496Bra006275Bra037183Bra006227Bra025225
Carica papayaevm.model.supercontig_6.275evm.model.supercontig_70.70evm.model.supercontig_2646.1evm.TU.contig_36966.1evm.model.supercontig_70.69
Capsella rubellaCarubv10000075mCarubv10002909mCarubv10027738mCarubv10016625m
Citrus clementinaCiclev10014083mCiclev10017635mCiclev10024829mCiclev10024800mCiclev10030627m
Ciclev10014156mCiclev10014160mCiclev10014123m
Citrus sinensisorange1.1g002547morange1.1g002518morange1.1g002134morange1.1g001061morange1.1g015028m
orange1.1g002366morange1.1g004057morange1.1g001910morange1.1g001850morange1.1g002764m
orange1.1g002170morange1.1g002162morange1.1g002383morange1.1g001963morange1.1g001813m
orange1.1g002938morange1.1g002542morange1.1g002064morange1.1g002056morange1.1g002046m
orange1.1g002036m
Cucumis sativusCucsa.339310.1Cucsa.043720.1Cucsa.188400.2Cucsa.188400.1
Eucalyptus grandisEucgr.J02166.1Eucgr.L01536.1Eucgr.J02456.1Eucgr.K02195.1Eucgr.J02455.3
Eucgr.J02455.2Eucgr.J02455.1Eucgr.I01600.1Eucgr.G01931.1Eucgr.J02460.1
Eucgr.J02454.1Eucgr.L01537.1Eucgr.J02457.1Eucgr.J02459.2Eucgr.J02459.1
Fragaria vescamrna28330.1-v1.0-hybridmrna14585.1-v1.0-hybridmrna01394.1-v1.0-hybrid.37.348mrna01394.1-v1.0-hybrid.37.348mrna06416.1-v1.0-hybrid.39.351
mrna06416.1-v1.0-hybrid.39.351mrna14589.1-v1.0-hybrid.71.344
Glycine maxGlyma13g04761.3Glyma13g04761.2Glyma19g01890.1Glyma02g05240.2Glyma02g05240.1
Glyma16g23600.1Glyma01g36980.1Glyma06g17270.1Glyma04g37790.1Glyma19g27660.2
Glyma19g27660.1Glyma16g05240.2Glyma16g05240.1
Gossypium raimondiiGorai.001G258600.2Gorai.001G258600.1Gorai.006G027500.1Gorai.003G008600.2Gorai.003G008600.1
Gorai.006G000300.3Gorai.006G000300.2Gorai.006G000300.1Gorai.012G082700.6Gorai.012G082700.9
Gorai.012G082700.8Gorai.012G082700.7Gorai.012G082700.5Gorai.012G082700.4Gorai.012G082700.3
Gorai.012G082700.2Gorai.012G082700.10Gorai.012G082700.1Gorai.003G116600.2Gorai.003G116600.1
Linum usitatissimumLus10014507Lus10015337.248.571Lus10015337.248.571Lus10032179Lus10039457
Lus10012578Lus10035111Lus10012577Lus10036074Lus10025960
Lus10014259Lus10041516Lus10015337.158.248Lus10015337.158.248
Malus domesticaMDP0000888429MDP0000267909MDP0000250936MDP0000139458MDP0000274501
MDP0000274500MDP0000409920MDP0000163211MDP0000657082MDP0000211018
Manihot esculentacassava4.1_000571mcassava4.1_001602mcassava4.1_000993mcassava4.1_000971mcassava4.1_000869m
cassava4.1_001123mcassava4.1_001106m
Medicago truncatulaMedtr4g071680.1Medtr6g008850.1Medtr8g075330.1Medtr7g084040.1Medtr3g098650.2
Medtr3g098650.1Medtr7g084030.1
Mimulus guttatusmgv1a000435mmgv1a000658mmgv1a000852mmgv1a000690m
Oryza sativaLOC_Os06g13650.2LOC_Os06g13650.1LOC_Os06g13650.3LOC_Os11g32260.2LOC_Os11g32260.1
LOC_Os10g05069.2LOC_Os10g05069.1LOC_Os10g05069.3
Panicum virgatumPavirv00027286mPavirv00014532mPavirv00024149mPavirv00025946mPavirv00065120m
Physcomitrella patensPp1s10_34V6.1Pp1s77_136V6.1Pp1s129_147V6.1
Phaseolus vulgarisPhvul.004G022500.1Phvul.003G264400.1Phvul.001G084400.1Phvul.002G107300.1Phvul.001G084700.1
Phvul.009G161600.1
Picea abiesMA_10434251g0010MA_879613g0010MA_4107059g0010
Populus trichocarpaPotri.017G073900.2Potri.017G073900.1Potri.001G350400.2Potri.001G350400.1Potri.014G143600.1
Potri.014G143600.2Potri.007G056300.1Potri.002G238200.2Potri.002G238200.1Potri.012G106500.2
Potri.012G106500.1
Prunus persicappa000458mppa021513mppa000707mppa000755mppa000717m
Ricinus communis29822.m00342029868.m00034130131.m00698230131.m00698130147.m014412
Setaria italicaSi005719mSi038673mSi025964mSi034056mSi025881m
Selaginella moellendorffii104910154366266756410022178241
Sorghum bicolorSb10g008770.1Sb01g026405.1Sb05g019600.1Sb01g026390.1
Thellungiella halophilaThhalv10012487mThhalv10012612mThhalv10012546mThhalv10003575mThhalv10003577m
Vitis viniferaGSVIVT01032586001GSVIVT01018752001GSVIVT01032988001GSVIVT01008340001GSVIVT01008642001
GSVIVT01032989001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)