y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma13g04761.3
FamilyGH38
Protein PropertiesLength: 964 Molecular Weight: 110176 Isoelectric Point: 6.35
ChromosomeChromosome/Scaffold: 13 Start: 5018977 End: 5026202
Descriptiongolgi alpha-mannosidase II
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH3832910
  YLERWWRDASDEMKESFINLVKNGQLEIVGGGWVMNDEANSHYFAIIEQIAEGNMWLNDTIGFVPKNSWAIDPFGYSSTMAYLLRRMGFDNMLIQRTHYE
  LKKELAWHKNLEYIWRQSWDAEETTDIFVHMMPFYSYDIPHTCGPEPAICCQFDFARMSGFAYEQCPWGQYPVETTQENVQERALKLLDQYKKKSTLYRT
  NTLLVPLGDDFRYINVEEAEAQFRNYQMLFDYINSNPSLNAEAKFGTLEDYFVTLREEAERINYSSPGEIGSGLVEGFPSLSGDFFTYA
Full Sequence
Protein Sequence     Length: 964     Download
MSYLERWWRD ASDEMKESFI NLVKNGQLEI VGGGWVMNDE ANSHYFAIIE QIAEGNMWLN    60
DTIGFVPKNS WAIDPFGYSS TMAYLLRRMG FDNMLIQRTH YELKKELAWH KNLEYIWRQS    120
WDAEETTDIF VHMMPFYSYD IPHTCGPEPA ICCQFDFARM SGFAYEQCPW GQYPVETTQE    180
NVQERALKLL DQYKKKSTLY RTNTLLVPLG DDFRYINVEE AEAQFRNYQM LFDYINSNPS    240
LNAEAKFGTL EDYFVTLREE AERINYSSPG EIGSGLVEGF PSLSGDFFTY ADRQQDYWSG    300
YYVSRPFFKA VDRVLEQTLR ATEMMVALIL GTCWRSHCEK FAMGFSYKLT AARRNLALFQ    360
HHDGVTGTAK DHVVMDYGMR MHTSLLDLQI FMSKAAEALL GIRFDKLDHS PAQFEPAIVR    420
SKYDAQPLHK VISVHEGSYE SVVFFNPLEQ TREEVVMVVV DSPDVTVVDS SWTCVQSQIL    480
PELQYHSSKI FTGKHRLYWK VSVPAMGLET YYISNSFAQC EKARPAKLKI FSKSSSVACP    540
TPYSCVKIEA DVAEIENEHQ KLIFDVKYGL LQKIISENSS PNTVNEEIGM YSSSGGAYLF    600
KPHGDAQSII EEGGQLLVSE GPLMQEVYSY PRTAWEKSPI SHSTRIYSGE STVQGFAIEK    660
EYHVELLGHD FNDRELIVRY KTDIDNKKIF YSDLNGFQMS RRETYDKIPL QGNYYPMPYL    720
AFIQGSNGRR FSVHSRQSLG VTSLKNGWLE IMVDRRLVRD DGRGLGQGVM DNRVMNVVFH    780
LTVEANVSAT SNLVPTPFPY SPSLLSHRVG SHLNYPIHAF VSKKPQDMSM KPPPRSFSPL    840
AAPLPCDLHI VNFKVPKPLK FLQQPPEGPR FGLILHRRHW DSSYCQKGRS QCTNLANGTM    900
NLFSMFKNLT VSKAKATSLN LLHEDPEVMG FSEQFGDLAQ EGHVAISPME IQAYKLELRP    960
QPQ*                                                                 1020
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00451GH38N_AMII_euk3.0e-801237238+
cd11667GH38N_Man2A25.0e-1251302302+
cd11666GH38N_Man2A11.0e-1291302302+
PLN02701PLN0270101959962+
cd10809GH38N_AMII_GMII_SfManIII_like01302302+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0004559alpha-mannosidase activity
GO:0005975carbohydrate metabolic process
GO:0006013mannose metabolic process
GO:0008270zinc ion binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI35021.1019601881056unnamed protein product [Vitis vinifera]
RefSeqNP_196999.1019612031172GMII (GOLGI ALPHA-MANNOSIDASE II); alpha-mannosidase [Arabidopsis thaliana]
RefSeqXP_002276468.1019601881149PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002438145.1019602171178hypothetical protein SORBIDRAFT_10g008770 [Sorghum bicolor]
RefSeqXP_002517418.1019612181179mannosidase alpha class 2a, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ps3_A01821131933A Chain A, Golgi Alpha-mannosidase Ii In Complex With Kifunensine
PDB3eju_A01821131933A Chain A, Golgi Alpha-mannosidase Ii In Complex With Kifunensine
PDB3ejt_A01821131933A Chain A, Golgi Alpha-mannosidase Ii In Complex With Kifunensine
PDB3ejs_A01821131933A Chain A, Golgi Alpha-mannosidase Ii In Complex With Kifunensine
PDB3ejr_A01821131933A Chain A, Golgi Alpha-mannosidase Ii In Complex With Kifunensine
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FL714386273383100
EH2611942536769280
HO78912222812280
CB662086281823620
FN761337250593080
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_00345.1.265.483Aquca_002_00345.1.265.483Aquca_006_00230.1Aquca_006_00257.5Aquca_006_00257.9
Aquca_006_00257.8Aquca_006_00257.7Aquca_006_00257.6Aquca_006_00257.4Aquca_006_00257.3
Aquca_006_00257.2Aquca_006_00257.1Aquca_043_00016.7Aquca_043_00016.8Aquca_043_00016.6
Aquca_043_00016.5Aquca_043_00016.4Aquca_043_00016.3Aquca_043_00016.2Aquca_043_00016.1
Aquca_043_00019.2Aquca_043_00019.1Aquca_043_00018.1Aquca_056_00071.1Aquca_002_00345.1.162.261
Aquca_002_00345.1.162.261
Arabidopsis lyrata488339488225497001484445
Arabidopsis thalianaAT5G14950.1AT5G66150.1AT5G13980.3AT5G13980.2AT5G13980.1
AT3G26720.2AT3G26720.1
Brachypodium distachyonBradi1g44550.1Bradi3g21117.1Bradi4g17327.1Bradi4g17317.1
Brassica rapaBra023496Bra006275Bra037183Bra006227Bra025225
Carica papayaevm.model.supercontig_6.275evm.model.supercontig_70.70evm.model.supercontig_2646.1evm.TU.contig_36966.1evm.model.supercontig_70.69
Capsella rubellaCarubv10000075mCarubv10002909mCarubv10027738mCarubv10016625m
Citrus clementinaCiclev10014083mCiclev10017635mCiclev10024829mCiclev10024800mCiclev10030627m
Ciclev10014156mCiclev10014160mCiclev10014123m
Citrus sinensisorange1.1g002547morange1.1g002518morange1.1g002134morange1.1g001061morange1.1g015028m
orange1.1g002366morange1.1g004057morange1.1g001910morange1.1g001850morange1.1g002764m
orange1.1g002170morange1.1g002162morange1.1g002383morange1.1g001963morange1.1g001813m
orange1.1g002938morange1.1g002542morange1.1g002064morange1.1g002056morange1.1g002046m
orange1.1g002036m
Cucumis sativusCucsa.339310.1Cucsa.043720.1Cucsa.188400.2Cucsa.188400.1
Eucalyptus grandisEucgr.J02166.1Eucgr.L01536.1Eucgr.J02456.1Eucgr.K02195.1Eucgr.J02455.3
Eucgr.J02455.2Eucgr.J02455.1Eucgr.I01600.1Eucgr.G01931.1Eucgr.J02460.1
Eucgr.J02454.1Eucgr.L01537.1Eucgr.J02457.1Eucgr.J02459.2Eucgr.J02459.1
Fragaria vescamrna28330.1-v1.0-hybridmrna14585.1-v1.0-hybridmrna01394.1-v1.0-hybrid.37.348mrna01394.1-v1.0-hybrid.37.348mrna06416.1-v1.0-hybrid.39.351
mrna06416.1-v1.0-hybrid.39.351mrna14589.1-v1.0-hybrid.71.344
Glycine maxGlyma13g04761.2Glyma19g01890.1Glyma13g04761.1Glyma02g05240.2Glyma02g05240.1
Glyma16g23600.1Glyma01g36980.1Glyma06g17270.1Glyma04g37790.1Glyma19g27660.2
Glyma19g27660.1Glyma16g05240.2Glyma16g05240.1
Gossypium raimondiiGorai.001G258600.2Gorai.001G258600.1Gorai.006G027500.1Gorai.003G008600.2Gorai.003G008600.1
Gorai.006G000300.3Gorai.006G000300.2Gorai.006G000300.1Gorai.012G082700.6Gorai.012G082700.9
Gorai.012G082700.8Gorai.012G082700.7Gorai.012G082700.5Gorai.012G082700.4Gorai.012G082700.3
Gorai.012G082700.2Gorai.012G082700.10Gorai.012G082700.1Gorai.003G116600.2Gorai.003G116600.1
Linum usitatissimumLus10014507Lus10015337.248.571Lus10015337.248.571Lus10032179Lus10039457
Lus10012578Lus10035111Lus10012577Lus10036074Lus10025960
Lus10014259Lus10041516Lus10015337.158.248Lus10015337.158.248
Malus domesticaMDP0000888429MDP0000267909MDP0000250936MDP0000139458MDP0000274501
MDP0000274500MDP0000409920MDP0000163211MDP0000657082MDP0000211018
Manihot esculentacassava4.1_000571mcassava4.1_001602mcassava4.1_000993mcassava4.1_000971mcassava4.1_000869m
cassava4.1_001123mcassava4.1_001106m
Medicago truncatulaMedtr4g071680.1Medtr6g008850.1Medtr8g075330.1Medtr7g084040.1Medtr3g098650.2
Medtr3g098650.1Medtr7g084030.1
Mimulus guttatusmgv1a000435mmgv1a000658mmgv1a000852mmgv1a000690m
Oryza sativaLOC_Os06g13650.2LOC_Os06g13650.1LOC_Os06g13650.3LOC_Os11g32260.2LOC_Os11g32260.1
LOC_Os10g05069.2LOC_Os10g05069.1LOC_Os10g05069.3
Panicum virgatumPavirv00027286mPavirv00014532mPavirv00024149mPavirv00025946mPavirv00065120m
Physcomitrella patensPp1s10_34V6.1Pp1s77_136V6.1Pp1s129_147V6.1
Phaseolus vulgarisPhvul.004G022500.1Phvul.003G264400.1Phvul.001G084400.1Phvul.002G107300.1Phvul.001G084700.1
Phvul.009G161600.1
Picea abiesMA_10434251g0010MA_879613g0010MA_4107059g0010
Populus trichocarpaPotri.017G073900.2Potri.017G073900.1Potri.001G350400.2Potri.001G350400.1Potri.014G143600.1
Potri.014G143600.2Potri.007G056300.1Potri.002G238200.2Potri.002G238200.1Potri.012G106500.2
Potri.012G106500.1
Prunus persicappa000458mppa021513mppa000707mppa000755mppa000717m
Ricinus communis29822.m00342029868.m00034130131.m00698230131.m00698130147.m014412
Setaria italicaSi005719mSi038673mSi025964mSi034056mSi025881m
Selaginella moellendorffii104910154366266756410022178241
Sorghum bicolorSb10g008770.1Sb01g026405.1Sb05g019600.1Sb01g026390.1
Thellungiella halophilaThhalv10012487mThhalv10012612mThhalv10012546mThhalv10003575mThhalv10003577m
Vitis viniferaGSVIVT01032586001GSVIVT01018752001GSVIVT01032988001GSVIVT01008340001GSVIVT01008642001
GSVIVT01032989001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)