y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma13g05601.1
FamilyGT1
Protein PropertiesLength: 150 Molecular Weight: 17264.3 Isoelectric Point: 8.362
ChromosomeChromosome/Scaffold: 13 Start: 5956337 End: 5956835
DescriptionUDP-glycosyltransferase 74 F1
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT151302.1e-23
  VVYVSFGSIVTFVQEQMEEVACYSREFSSYFLWVVKASEEIKLPMRKEQKRAVGCFVIHCGWNSILQTLCLGVPIIGIPCWSDQRTNAKLIADVWKIGIR
  TPIDEKNIVRQEALKHCIKEIMDGDK
Full Sequence
Protein Sequence     Length: 150     Download
MVNIVVYVSF GSIVTFVQEQ MEEVACYSRE FSSYFLWVVK ASEEIKLPMR KEQKRAVGCF    60
VIHCGWNSIL QTLCLGVPII GIPCWSDQRT NAKLIADVWK IGIRTPIDEK NIVRQEALKH    120
CIKEIMDGDK EMKTNVIQWR TLAIYKSYQ*                                     180
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02210PLN022108.0e-245128145+
PLN02448PLN024483.0e-252133156+
PLN02555PLN025557.0e-305143168+
PLN02152PLN021521.0e-325144172+
PLN02173PLN021732.0e-435144163+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABN08985.10514459218UDP-glucuronosyl/UDP-glucosyltransferase [Medicago truncatula]
GenBankABN08986.105144273432UDP-glucuronosyl/UDP-glucosyltransferase [Medicago truncatula]
GenBankABN08989.19.94922e-445143275434UDP-glucuronosyl/UDP-glucosyltransferase [Medicago truncatula]
GenBankACU19612.105144272431unknown [Glycine max]
DDBJBAB86925.10514493252glucosyltransferase-7 [Vigna angularis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2pq6_A3e-165143297456A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2acw_B3e-165137278444A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
PDB2acw_A3e-165137278444A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
PDB2acv_B3e-165137278444A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
PDB2acv_A3e-165137278444A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
Metabolic Pathways
Pathway NameReactionECProtein Name
crocetin esters biosynthesisRXN-8471EC-2.4.1.271crocetin glucosyltransferase
crocetin esters biosynthesisRXN-8473EC-2.4.1.271crocetin glucosyltransferase
crocetin esters biosynthesisRXN-8475EC-2.4.1.271crocetin glucosyltransferase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CO98485816351490
EH219444156121490
GR84224416051440
GR84224316051440
CV54363015851440
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_083_00035.1Aquca_032_00010.1Aquca_083_00040.1Aquca_066_00059.1Aquca_002_00093.1
Aquca_002_00095.1Aquca_014_00200.1Aquca_002_00304.1Aquca_015_00237.1Aquca_058_00020.1
Aquca_015_00236.1Aquca_083_00033.1Aquca_045_00003.1Aquca_014_00201.1Aquca_042_00011.1
Aquca_034_00091.1Aquca_034_00094.1Aquca_083_00034.1
Arabidopsis lyrata470571481198900805483500902214
482098889955470572483498887739
887744493341493342479675493340
915488493327915253
Arabidopsis thalianaAT1G05675.1AT1G05680.1AT2G43840.2AT2G43840.1AT2G23250.1
AT2G31790.1AT1G24100.1AT2G31750.1AT2G43820.1AT1G05560.1
AT1G05530.1AT4G15490.1AT3G21560.1AT4G15480.1AT4G14090.1
AT4G15500.1AT4G15550.1AT2G23260.1
Brachypodium distachyonBradi3g06487.1Bradi5g03300.1Bradi5g03390.1Bradi1g37030.1Bradi2g17320.1
Bradi4g35342.1Bradi4g35350.1Bradi5g02780.1Bradi5g03380.1Bradi5g03370.1
Bradi4g35356.1Bradi5g03320.1Bradi1g37050.1Bradi3g07557.1Bradi2g05042.1
Bradi2g05050.1Bradi2g46820.1Bradi4g42997.1Bradi2g12347.1Bradi2g33940.1
Bradi5g03400.1Bradi4g26560.1Bradi1g11940.1
Brassica rapaBra022864Bra000330Bra000329Bra039192Bra021743
Bra005641Bra030620Bra015448Bra021740Bra024634
Bra004787Bra004788Bra031483Bra038445Bra017882
Bra039547Bra012784Bra039545Bra031290Bra023872
Bra015435Bra039544Bra039191Bra032179Bra033494
Bra038080Bra038079
Carica papayaevm.model.supercontig_6.92evm.model.supercontig_1205.2evm.model.supercontig_1205.3evm.model.supercontig_106.99evm.model.supercontig_601.4
evm.model.supercontig_5.342evm.model.supercontig_5.341evm.model.supercontig_157.30
Capsella rubellaCarubv10010859mCarubv10025112mCarubv10006803mCarubv10023202mCarubv10025420m
Carubv10009070mCarubv10023181mCarubv10025301mCarubv10009096mCarubv10024869m
Carubv10011842mCarubv10009073mCarubv10013531mCarubv10025476mCarubv10024992m
Carubv10007541mCarubv10007399mCarubv10004723mCarubv10004716mCarubv10028525m
Carubv10007186mCarubv10007134mCarubv10007692m
Citrus clementinaCiclev10015147mCiclev10018164mCiclev10015138mCiclev10028247mCiclev10015145m
Ciclev10023826mCiclev10020081mCiclev10015140mCiclev10017682mCiclev10020092m
Ciclev10015155mCiclev10015149mCiclev10031201mCiclev10028293mCiclev10017665m
Ciclev10023445mCiclev10027383mCiclev10004909mCiclev10019912mCiclev10017641m
Citrus sinensisorange1.1g038830morange1.1g012194morange1.1g012645morange1.1g012412morange1.1g048393m
orange1.1g012277morange1.1g046339morange1.1g036740morange1.1g041902morange1.1g045998m
orange1.1g035557morange1.1g036519m
Cucumis sativusCucsa.219460.1Cucsa.073120.1Cucsa.184880.1Cucsa.156270.1Cucsa.345960.1
Cucsa.149960.1Cucsa.327680.1Cucsa.327670.1Cucsa.389830.1Cucsa.149970.1
Cucsa.345950.1Cucsa.327660.1Cucsa.345990.1Cucsa.120520.1Cucsa.120500.1
Cucsa.219470.1Cucsa.135920.1Cucsa.120510.1
Eucalyptus grandisEucgr.G01348.1Eucgr.K02352.1Eucgr.K02355.1Eucgr.K02355.2Eucgr.K02356.1
Eucgr.G01344.1Eucgr.H00503.1Eucgr.H00279.1Eucgr.H00694.1Eucgr.H00275.1
Eucgr.H00277.1Eucgr.H00692.1Eucgr.H00266.1Eucgr.H00263.1Eucgr.H00273.1
Eucgr.K02353.1Eucgr.B02563.1Eucgr.H00270.1Eucgr.H00268.1Eucgr.H00261.1
Eucgr.H00695.1Eucgr.H00261.2Eucgr.L03174.1Eucgr.G01342.1Eucgr.I01103.1
Eucgr.K02875.1Eucgr.H00262.1Eucgr.H00697.1Eucgr.H02643.1Eucgr.H02640.1
Eucgr.L00635.1Eucgr.L00636.1Eucgr.H02641.1Eucgr.H00691.1Eucgr.H02638.1
Eucgr.L00634.1Eucgr.H00004.1Eucgr.H02644.1Eucgr.H02642.1Eucgr.L01046.1
Eucgr.L00631.1Eucgr.L00632.1Eucgr.L01047.1Eucgr.D01218.1Eucgr.H02639.1
Eucgr.H00001.1Eucgr.H00502.1Eucgr.H00007.1Eucgr.C04261.1Eucgr.H00698.1
Fragaria vescamrna25367.1-v1.0-hybridmrna25368.1-v1.0-hybridmrna22460.1-v1.0-hybridmrna25361.1-v1.0-hybridmrna01800.1-v1.0-hybrid
mrna25363.1-v1.0-hybridmrna09479.1-v1.0-hybridmrna17480.1-v1.0-hybridmrna10134.1-v1.0-hybridmrna00708.1-v1.0-hybrid.714.883
mrna00708.1-v1.0-hybrid.714.883mrna00708.1-v1.0-hybrid.262.422mrna00708.1-v1.0-hybrid.262.422mrna06602.1-v1.0-hybridmrna06600.1-v1.0-hybrid
mrna29832.1-v1.0-hybridmrna06601.1-v1.0-hybridmrna26265.1-v1.0-hybridmrna06599.1-v1.0-hybridmrna26479.1-v1.0-hybrid
mrna22459.1-v1.0-hybridmrna26249.1-v1.0-hybrid
Glycine maxGlyma09g38140.2Glyma08g13230.1Glyma01g04250.1Glyma19g03010.1Glyma16g27440.1
Glyma09g38130.1Glyma13g24230.1Glyma02g03420.1Glyma19g03000.2Glyma18g48230.1
Glyma13g05580.1Glyma18g48250.1Glyma13g05590.1Glyma08g11330.1Glyma17g18220.2
Glyma05g28330.1Glyma05g28340.1Glyma18g00620.1Glyma10g40900.1Glyma20g26420.1
Gossypium raimondiiGorai.005G234600.1.57.433Gorai.005G234600.1.57.433Gorai.001G226600.1Gorai.001G226500.1Gorai.002G164900.2
Gorai.002G164900.1Gorai.009G344800.1Gorai.011G131200.1Gorai.003G157800.1Gorai.009G328300.1
Gorai.005G007900.1Gorai.005G008000.1Gorai.005G008100.1Gorai.005G234600.1.545.898Gorai.005G234600.1.545.898
Gorai.011G176600.1Gorai.005G234700.1Gorai.005G025400.1Gorai.005G025500.1Gorai.005G025600.1
Gorai.005G025700.1Gorai.005G026200.1Gorai.005G025900.1Gorai.003G047900.1Gorai.007G218400.1
Gorai.005G026100.1
Linum usitatissimumLus10006352Lus10017825Lus10006353Lus10024118Lus10014148
Lus10009412Lus10010468Lus10006351Lus10008742Lus10006721
Lus10003809Lus10020559Lus10024486Lus10010712Lus10020556
Lus10024117Lus10024834Lus10039041Lus10029197Lus10027862
Lus10021610Lus10006720.10.141Lus10006720.10.141Lus10014105Lus10019808
Lus10019809Lus10015515Lus10019989Lus10040591Lus10010469
Lus10010467Lus10029466
Malus domesticaMDP0000125167MDP0000143804MDP0000250047MDP0000267341MDP0000250223
MDP0000684216MDP0000891353MDP0000150382MDP0000662428MDP0000239301
MDP0000545122MDP0000617956MDP0000158799MDP0000733506MDP0000229280
MDP0000506825MDP0000278892MDP0000718430MDP0000839414MDP0000122478
Manihot esculentacassava4.1_031168mcassava4.1_005904mcassava4.1_021903mcassava4.1_007291mcassava4.1_006987m
cassava4.1_022886mcassava4.1_024544mcassava4.1_034023mcassava4.1_024094mcassava4.1_030178m
cassava4.1_033162mcassava4.1_025968mcassava4.1_007706mcassava4.1_013962mcassava4.1_034011m
cassava4.1_031975mcassava4.1_024325mcassava4.1_006949mcassava4.1_034307mcassava4.1_007134m
cassava4.1_028982mcassava4.1_027880mcassava4.1_009833mcassava4.1_006110mcassava4.1_022255m
cassava4.1_006627m
Medicago truncatulaMedtr5g016480.1Medtr7g080950.1Medtr5g035560.1Medtr5g035580.1Medtr8g088560.1
Medtr7g080935.1Medtr7g080900.1Medtr7g080940.1Medtr3g084520.1Medtr8g083280.1
Medtr8g083290.1Medtr3g084530.1Medtr3g084540.1Medtr3g049970.1Medtr7g080960.1
Mimulus guttatusmgv1a023901mmgv1a006064mmgv1a020645mmgv1a005301mmgv1a006216m
mgv1a006158mmgv1a006214mmgv1a025741mmgv1a006023mmgv1a005398m
mgv1a018203mmgv1a005918mmgv1a026355mmgv1a026563mmgv1a007491m
mgv1a005538mmgv1a021119mmgv1a023035mmgv1a024986mmgv1a025083m
Oryza sativaLOC_Os05g47950.1LOC_Os04g12960.1LOC_Os04g12900.1LOC_Os02g10880.1LOC_Os09g34270.1
LOC_Os04g12980.1LOC_Os09g34214.1LOC_Os09g34230.1LOC_Os09g34250.1LOC_Os03g48740.1
LOC_Os04g12970.1LOC_Os04g12950.1LOC_Os04g12720.1LOC_Os02g09510.1LOC_Os01g49240.1
LOC_Os01g49230.1LOC_Os06g39330.1LOC_Os06g39270.1LOC_Os01g08440.1LOC_Os11g25990.1
LOC_Os05g08750.1LOC_Os11g04860.1
Panicum virgatumPavirv00009723mPavirv00026932mPavirv00064072mPavirv00024694mPavirv00014304m
Pavirv00059702mPavirv00067747mPavirv00012880mPavirv00037210mPavirv00002184m
Pavirv00030202mPavirv00014827mPavirv00011652mPavirv00055952mPavirv00002185m
Pavirv00026097mPavirv00046800mPavirv00027365mPavirv00049307mPavirv00046840m
Pavirv00031346mPavirv00025927mPavirv00021487mPavirv00023346mPavirv00048842m
Pavirv00063892mPavirv00058277mPavirv00063379mPavirv00050234mPavirv00003949m
Pavirv00027250mPavirv00059578mPavirv00047007mPavirv00056141mPavirv00059759m
Pavirv00065505mPavirv00037261mPavirv00066786mPavirv00035655mPavirv00026950m
Pavirv00025237mPavirv00000492mPavirv00002859mPavirv00025617mPavirv00020371m
Pavirv00020306mPavirv00013675m
Phaseolus vulgarisPhvul.007G039500.1Phvul.007G039600.1Phvul.007G039400.1Phvul.002G247700.1Phvul.002G075200.1
Phvul.011G184600.1Phvul.004G086500.1Phvul.004G029500.1Phvul.004G031100.1Phvul.004G030400.1
Phvul.009G115200.1Phvul.004G024500.1Phvul.004G031000.1Phvul.007G039300.1Phvul.001G265400.1
Phvul.003G239700.1Phvul.007G039200.1
Picea abiesMA_10268298g0010MA_634631g0010MA_49332g0010MA_732668g0010MA_310012g0010
MA_9523098g0010MA_10428368g0020MA_10433477g0020.690.861MA_10433477g0020.690.861MA_207511g0010
MA_10428919g0010MA_625682g0010MA_476822g0010MA_89176g0010MA_121428g0010
MA_143140g0010MA_12952g0010MA_10433477g0020.184.400MA_10433477g0020.184.400MA_8902024g0010
MA_10436215g0020MA_239168g0010MA_901723g0010MA_95387g0010MA_796003g0010
MA_10429829g0010
Populus trichocarpaPotri.007G049600.1Potri.007G140300.1Potri.007G141900.1Potri.009G095500.1Potri.014G175000.1
Potri.007G117200.1Potri.004G179300.1Potri.015G071900.1Potri.001G389200.1Potri.017G032500.1
Potri.017G032300.1Potri.017G032700.1Potri.007G140500.1Potri.009G095100.1Potri.009G095300.1
Potri.004G083700.1Potri.007G141700.1Potri.017G101800.1Potri.009G095400.1Potri.016G052500.1
Potri.006G055600.1Potri.007G140600.1Potri.002G236400.1Potri.009G095200.1Potri.014G146000.1
Potri.007G140700.1Potri.007G117300.1
Prunus persicappa005386mppa005475mppa020804mppa005722mppa005294m
ppa016463mppa016444mppa016883mppa026200mppa016486m
ppa005780mppa020679mppa016890mppa012496mppa021645m
ppa005161mppa024612mppa005173mppa021082mppa005187m
Ricinus communis29970.m00099229970.m00099329801.m00308829678.m00051227866.m000223
29801.m00308727866.m00022427866.m00023229736.m00211929678.m000509
29678.m00051029678.m00051129678.m00051329678.m00050829801.m003090
29801.m00308930183.m001298
Setaria italicaSi010049mSi029756mSi035595mSi008274mSi006344m
Si029769mSi006350mSi008226mSi004704mSi012087m
Si029755mSi029697mSi031926mSi010006mSi035385m
Si019285mSi001341mSi024864mSi016917mSi007900m
Si010556mSi012300m
Sorghum bicolorSb03g005340.1Sb02g030040.1Sb04g005960.1Sb06g002180.1Sb01g031560.1
Sb10g009990.1Sb02g030050.1Sb02g030030.1Sb02g030020.1Sb01g021110.1
Sb01g011390.1Sb01g031540.1Sb02g030060.1Sb03g006390.1Sb03g006410.1
Sb10g023060.1Sb03g003760.1Sb10g023120.1Sb09g027760.1Sb09g005510.1
Sb06g018240.1Sb10g023070.1Sb08g001100.1Sb05g002700.1Sb05g002710.1
Sb10g023050.1
Thellungiella halophilaThhalv10001440mThhalv10024946mThhalv10007603mThhalv10016636mThhalv10001441m
Thhalv10007574mThhalv10016638mThhalv10025167mThhalv10007593mThhalv10007589m
Thhalv10025056mThhalv10020520mThhalv10025072mThhalv10025055mThhalv10027288m
Thhalv10000612mThhalv10000540mThhalv10000452mThhalv10000436mThhalv10027441m
Vitis viniferaGSVIVT01038200001GSVIVT01038207001GSVIVT01005733001GSVIVT01038204001GSVIVT01038206001
GSVIVT01038203001GSVIVT01031615001GSVIVT01020177001GSVIVT01031600001GSVIVT01031580001
Zea maysAC199541.4_FGT002AC199541.4_FGT001AC199541.4_FGT004AC199541.4_FGT007
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)