y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma13g06040.1
FamilyGT35
Protein PropertiesLength: 979 Molecular Weight: 110039 Isoelectric Point: 5.446
ChromosomeChromosome/Scaffold: 13 Start: 6339187 End: 6349183
DescriptionGlycosyl transferase, family 35
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT351819730
  ALSKLGHKLENVAYQEPDAALGNGGLGRLASCFLDSLATLNYPAWGYGLRYKYGLFKQRITKDGQEEVADDWLEMGNPWEIIRNDVSYPVKFYGKVVSGS
  DGKKHWIGGEDIKAVAHDVPIPGYKTKTTINLRLWSTKAASEEFDLSAFNAGRHTEASEALANAEKICYILYPGDESIEGKILRLKQQYTLCSASLQDII
  ARFERRSGTNVNWEEFPEKVAVQMNDTHPTLCIPELMRILIDVKGLSWKDAWNITQRTVAYTNHTVLPEALEKWSLDLMQKLLPRHIEIIEMIDEELIRT
  IIAEYGTENSDLLEKKLKEMRILENVELPAEFADIVVKSKEAIDIPSEELQSSEQAEVEERKDDEVEAVAKKNGTDESSIEDEKEELPEPVPEPPKLVRM
  ANLCVVGGHAVNGVAEIHSEIVKDEVFNAFYKLWPEKFQNKTNGVTPRRWIRFCNPDLSKIITEWIGTEDWVLNTGKLAELRKFVDNEDLQVQWREAKRS
  NKVKVAAFIREKTGYSVSPDAMFDIQVKRIHEYKRQLLNIFGIVYRYKKMKEMSAAERKANFVPRVCIFGGKAFATYVQAKRIVKFITDVGATVNHDPEI
  GDLLKVVFVPDYNVSVAEMLIPASELSQHISTAGMEASGTSNMKFAMNGCILIGTLDGANVEIREEVGADNFFLFGAKAHEIAGLRKERAEGKFVPDPRF
  EEVKEFVRSGVFGSYNYDELMGSLEGNEGFGRADYFLVGKDFPSYIECQEKVDEAYRNQTKWTRMSILNTAGSYKFSSDRTIHEYAREIWNIE
Full Sequence
Protein Sequence     Length: 979     Download
MASSATMRFS ATSTGAEAAL PRRNSVAGFI GVAARSSAKS RLRFIGRNAN LSLRRRMSSF    60
PVVKCVSGSE AKAQDPVAKQ QEATTSLSSF SPDASSIASS IKYHAEFTPL FSPENFDLPQ    120
AFLATAQSVR DALIINWNAT YDYYEKLNVK QAYYLSMEFL QGRALLNAIG NLELTGPHAE    180
ALSKLGHKLE NVAYQEPDAA LGNGGLGRLA SCFLDSLATL NYPAWGYGLR YKYGLFKQRI    240
TKDGQEEVAD DWLEMGNPWE IIRNDVSYPV KFYGKVVSGS DGKKHWIGGE DIKAVAHDVP    300
IPGYKTKTTI NLRLWSTKAA SEEFDLSAFN AGRHTEASEA LANAEKICYI LYPGDESIEG    360
KILRLKQQYT LCSASLQDII ARFERRSGTN VNWEEFPEKV AVQMNDTHPT LCIPELMRIL    420
IDVKGLSWKD AWNITQRTVA YTNHTVLPEA LEKWSLDLMQ KLLPRHIEII EMIDEELIRT    480
IIAEYGTENS DLLEKKLKEM RILENVELPA EFADIVVKSK EAIDIPSEEL QSSEQAEVEE    540
RKDDEVEAVA KKNGTDESSI EDEKEELPEP VPEPPKLVRM ANLCVVGGHA VNGVAEIHSE    600
IVKDEVFNAF YKLWPEKFQN KTNGVTPRRW IRFCNPDLSK IITEWIGTED WVLNTGKLAE    660
LRKFVDNEDL QVQWREAKRS NKVKVAAFIR EKTGYSVSPD AMFDIQVKRI HEYKRQLLNI    720
FGIVYRYKKM KEMSAAERKA NFVPRVCIFG GKAFATYVQA KRIVKFITDV GATVNHDPEI    780
GDLLKVVFVP DYNVSVAEML IPASELSQHI STAGMEASGT SNMKFAMNGC ILIGTLDGAN    840
VEIREEVGAD NFFLFGAKAH EIAGLRKERA EGKFVPDPRF EEVKEFVRSG VFGSYNYDEL    900
MGSLEGNEGF GRADYFLVGK DFPSYIECQE KVDEAYRNQT KWTRMSILNT AGSYKFSSDR    960
TIHEYAREIW NIEPVQLP*                                                 1020
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00343Phosphorylase2.0e-132181504324+
cd04300GT1_Glycogen_Phosphorylase2.0e-179101505409+
cd04300GT1_Glycogen_Phosphorylase0579972403+
pfam00343Phosphorylase0579974401+
TIGR02093P_ylase0579972399+
Gene Ontology
GO TermDescription
GO:0004645phosphorylase activity
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACJ11757.10589782935alpha-1,4 glucan phosphorylase [Gossypium hirsutum]
EMBLCBI22291.102997826982unnamed protein product [Vitis vinifera]
Swiss-ProtP535360397721002PHSL_VICFA RecName: Full=Alpha-1,4 glucan phosphorylase L isozyme, chloroplastic/amyloplastic; AltName: Full=Starch phosphorylase L; Flags: Precursor
RefSeqXP_002305367.10489782949predicted protein [Populus trichocarpa]
RefSeqXP_002526085.10119782977glycogen phosphorylase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2azd_B014897057792A Chain A, Recombinant Horseradish Peroxidase Phe209ser Complex With Benzhydroxamic Acid
PDB2azd_A014897057792A Chain A, Recombinant Horseradish Peroxidase Phe209ser Complex With Benzhydroxamic Acid
PDB2aw3_B014897057792A Chain A, Recombinant Horseradish Peroxidase Phe209ser Complex With Benzhydroxamic Acid
PDB2aw3_A014897057792A Chain A, Recombinant Horseradish Peroxidase Phe209ser Complex With Benzhydroxamic Acid
PDB2av6_B014897057792A Chain A, Recombinant Horseradish Peroxidase Phe209ser Complex With Benzhydroxamic Acid
Metabolic Pathways
Pathway NameReactionECProtein Name
starch degradation IRXN-1826EC-2.4.1.1phosphorylase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7783038641219790
HO7971784235579790
HO6139545224589790
HO6207674015799790
HO77830312331232e-37
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_009_00755.3Aquca_009_00755.2Aquca_009_00755.1Aquca_002_00786.1Aquca_002_00786.2
Arabidopsis lyrata485074323006
Arabidopsis thalianaAT3G46970.1AT3G29320.1
Brachypodium distachyonBradi2g55120.1Bradi1g08070.1.569.972Bradi1g08070.1.569.972Bradi1g08070.1.163.525Bradi1g08070.1.163.525
Brassica rapaBra018180Bra025392Bra033098
Carica papayaevm.model.supercontig_27.5evm.model.supercontig_112.64.358.739evm.model.supercontig_112.64.358.739evm.model.supercontig_14.158evm.model.supercontig_112.64.117.357
evm.model.supercontig_112.64.117.357
Capsella rubellaCarubv10019408mCarubv10016634m
Chlamydomonas reinhardtiiCre12.g552200.t1.2Cre07.g336950.t1.1
Citrus clementinaCiclev10027815mCiclev10027813mCiclev10010975m.585.995Ciclev10010975m.585.995Ciclev10010975m.176.514
Ciclev10010975m.176.514
Citrus sinensisorange1.1g004485morange1.1g003202morange1.1g003197morange1.1g003196morange1.1g003188m
orange1.1g003186morange1.1g005595morange1.1g003693morange1.1g003742morange1.1g004697m
orange1.1g004696morange1.1g007597morange1.1g003875m.374.784orange1.1g003875m.374.784orange1.1g003079m.434.844
orange1.1g003079m.434.844orange1.1g003074m.434.844orange1.1g003074m.434.844orange1.1g003072m.434.844orange1.1g003072m.434.844
orange1.1g003055m.436.846orange1.1g003055m.436.846orange1.1g001879m.585.995orange1.1g001879m.585.995orange1.1g009651m
orange1.1g002111morange1.1g012447morange1.1g005402m.400.692orange1.1g005402m.400.692orange1.1g005402m.25.349
orange1.1g005402m.25.349orange1.1g003079m.25.349orange1.1g003079m.25.349orange1.1g003074m.25.349orange1.1g003074m.25.349
orange1.1g003072m.25.349orange1.1g003072m.25.349orange1.1g001879m.176.500orange1.1g001879m.176.500orange1.1g003055m.25.351
orange1.1g003055m.25.351orange1.1g026345m
Cucumis sativusCucsa.126920.10Cucsa.126920.1Cucsa.139040.4Cucsa.139040.3Cucsa.139040.2
Cucsa.139040.1Cucsa.284600.1Cucsa.273090.1
Eucalyptus grandisEucgr.B02278.2Eucgr.B02278.1Eucgr.B03166.3Eucgr.B03166.2Eucgr.J01374.1
Eucgr.B03166.1Eucgr.B03166.5Eucgr.B03166.4
Fragaria vescamrna29749.1-v1.0-hybridmrna07968.1-v1.0-hybridmrna04322.1-v1.0-hybrid.157.481mrna04322.1-v1.0-hybrid.157.481
Glycine maxGlyma13g30920.2Glyma13g30920.3Glyma08g45210.1Glyma18g07480.1Glyma20g03250.4.554.965
Glyma20g03250.4.554.965Glyma20g03250.3.562.973Glyma20g03250.3.562.973Glyma20g03250.2.562.973Glyma20g03250.2.562.973
Glyma19g03490.1Glyma20g03250.4.161.485Glyma20g03250.4.161.485Glyma20g03250.3.169.493Glyma20g03250.3.169.493
Glyma20g03250.2.169.493Glyma20g03250.2.169.493
Gossypium raimondiiGorai.009G166800.1Gorai.013G260900.2Gorai.013G260900.1Gorai.013G260900.3Gorai.006G011500.7.330.728
Gorai.006G011500.7.330.728Gorai.006G011500.4.514.912Gorai.006G011500.4.514.912Gorai.006G011500.3.580.978Gorai.006G011500.3.580.978
Gorai.006G011500.2.583.981Gorai.006G011500.2.583.981Gorai.006G011500.1.583.986Gorai.006G011500.1.583.986Gorai.013G092200.1
Gorai.013G092200.2Gorai.006G011500.6.177.501Gorai.006G011500.6.177.501Gorai.006G011500.5.180.504Gorai.006G011500.5.180.504
Gorai.006G011500.4.111.435Gorai.006G011500.4.111.435Gorai.006G011500.3.177.501Gorai.006G011500.3.177.501Gorai.006G011500.2.180.504
Gorai.006G011500.2.180.504Gorai.006G011500.1.180.504Gorai.006G011500.1.180.504Gorai.006G011500.6.580.815Gorai.006G011500.6.580.815
Gorai.006G011500.5.583.818Gorai.006G011500.5.583.818
Linum usitatissimumLus10036892Lus10042688Lus10037093Lus10029643Lus10029644
Malus domesticaMDP0000288190MDP0000123354MDP0000266061MDP0000129346.602.999MDP0000129346.602.999
MDP0000145828MDP0000128518MDP0000778598MDP0000259799MDP0000129346.170.509
MDP0000129346.170.509MDP0000211642
Manihot esculentacassava4.1_001626mcassava4.1_002082mcassava4.1_024481mcassava4.1_002466mcassava4.1_002614m.310.707
cassava4.1_002614m.310.707cassava4.1_001096mcassava4.1_025456mcassava4.1_007176mcassava4.1_004717m.211.560
cassava4.1_004717m.211.560cassava4.1_002614m.25.217cassava4.1_002614m.25.217cassava4.1_004717m.25.195cassava4.1_004717m.25.195
cassava4.1_009211m
Medicago truncatulaMedtr2g014460.1Medtr6g014480.1Medtr4g082950.1.578.876Medtr4g082950.1.578.876Medtr4g082950.1.170.494
Medtr4g082950.1.170.494Medtr6g014480.2
Mimulus guttatusmgv1a000698mmgv1a001277mmgv1a000878mmgv1a002586mmgv1a002585m
Oryza sativaLOC_Os01g63270.1LOC_Os01g63270.2LOC_Os03g55090.1
Panicum virgatumPavirv00009874mPavirv00050649mPavirv00050650mPavirv00004990m.515.914Pavirv00004990m.515.914
Pavirv00034922m.529.918Pavirv00034922m.529.918Pavirv00034922m.119.465Pavirv00034922m.119.465Pavirv00004990m.97.438
Pavirv00004990m.97.438
Physcomitrella patensPp1s30_182V6.1Pp1s180_124V6.1Pp1s86_213V6.1Pp1s195_41V6.1Pp1s53_212V6.1.566.981
Pp1s53_212V6.1.566.981Pp1s53_212V6.1.179.499Pp1s53_212V6.1.179.499
Phaseolus vulgarisPhvul.006G182300.1Phvul.006G064100.1Phvul.002G168400.1.570.971Phvul.002G168400.1.570.971Phvul.004G034400.1.582.980
Phvul.004G034400.1.582.980Phvul.002G168400.1.169.519Phvul.002G168400.1.169.519Phvul.004G034400.1.180.504Phvul.004G034400.1.180.504
Picea abiesMA_10437129g0010MA_14581g0010MA_10428980g0010
Populus trichocarpaPotri.004G048600.1Potri.004G048600.2Potri.009G041800.1Potri.009G041800.3Potri.010G160200.2
Potri.009G041800.4Potri.009G041800.2.126.655Potri.009G041800.2.126.655Potri.004G123600.5Potri.010G160200.5
Potri.010G160200.1Potri.010G160200.7Potri.010G160200.4Potri.010G160200.3Potri.004G123600.4.176.534
Potri.004G123600.4.176.534Potri.004G123600.3.176.534Potri.004G123600.3.176.534Potri.004G123600.2.176.534Potri.004G123600.2.176.534
Potri.004G123600.1.176.533Potri.004G123600.1.176.533Potri.010G160200.6Potri.009G041800.2.660.825Potri.009G041800.2.660.825
Prunus persicappa000587mppa001354mppa000958mppa000827m.586.983ppa000827m.586.983
ppa000827m.171.506ppa000827m.171.506
Ricinus communis29751.m00179630190.m011310.461.94330190.m011310.461.94330174.m00913629630.m000793
30190.m011310.264.44430190.m011310.264.444
Setaria italicaSi000306mSi034019m
Selaginella moellendorffii148158164611184206
Sorghum bicolorSb03g040060.1Sb01g007560.2.550.949Sb01g007560.2.550.949Sb01g007560.1.580.979Sb01g007560.1.580.979
Sb01g007560.2.140.492Sb01g007560.2.140.492Sb01g007560.1.170.522Sb01g007560.1.170.522
Thellungiella halophilaThhalv10010122mThhalv10003599m
Vitis viniferaGSVIVT01021111001GSVIVT01024804001GSVIVT01012194001GSVIVT01011504001.577.977GSVIVT01011504001.577.977
GSVIVT01011504001.177.501GSVIVT01011504001.177.501
Volvox carteriVocar20006426mVocar20001423m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)