y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma13g07220.1
FamilyGH81
Protein PropertiesLength: 722 Molecular Weight: 80764.2 Isoelectric Point: 6.3747
ChromosomeChromosome/Scaffold: 13 Start: 7383169 End: 7385575
Descriptionglycosyl hydrolase family 81 protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH81717140
  TVLPDPSKFFSSNLLSSPLPTNSFFQNFVLKNGDQQEYIHPYLIKSSNSSLSLSYPSRQASSAVIFQVFNPDLTISAPQGPKQGPPGKHLISSYSDLSVT
  LDFPSSNLSFFLVRGSPYLTVSVTQPTPLSITTIHSILSFSSNDSNTKYTFQFNNGQTWLLYATSPIKLNHTLSEITSNAFSGIIRIALLPDSDSKHEAV
  LDKYSSCYPVSGKAVFREPFCVEYNWEKKDSGDLLLLAHPLHVQLLRNGDNDVKILEDLKYKSIDGDLVGVVGDSWVLKTDPLFVTWHSIKGIKEESHDE
  IVSALSKDVESLDSSSITTTESYFYGKLIARAARLVLIAEELNYPDVIPKVRNFLKETIEPWLEGTFSGNGFLHDEKWGGIITQKGSTDAGGDFGFGIYN
  DHHYHLGYFIYGIAVLTKLDPAWGRKYKPQAYSIVQDFLNLDTKLNSNYTRLRCFDPYVLHSWAGGLTEFTDGRNQESTSEAVSAYYSAALMGLAYGDVP
  LVALGSTLTALEIEGTKMWWHVKEGGTLYEKEFTQENRVMGVLWSNKRDTGLWFAPAEWKECRLGIQLLPLAPISEAIFSNVDFVKELVEWTLPALDREG
  GVGEGWKGFVYALEGVYDNESALQKIRNLKGFDGGNSLTNLLWW
Full Sequence
Protein Sequence     Length: 722     Download
MKTINSKKQV HSSQAPQTLK NPYIFMITIH HLQHHHSTIV HHNQTRIKPP SATMVNIQTN    60
TSYIFPQTQS TVLPDPSKFF SSNLLSSPLP TNSFFQNFVL KNGDQQEYIH PYLIKSSNSS    120
LSLSYPSRQA SSAVIFQVFN PDLTISAPQG PKQGPPGKHL ISSYSDLSVT LDFPSSNLSF    180
FLVRGSPYLT VSVTQPTPLS ITTIHSILSF SSNDSNTKYT FQFNNGQTWL LYATSPIKLN    240
HTLSEITSNA FSGIIRIALL PDSDSKHEAV LDKYSSCYPV SGKAVFREPF CVEYNWEKKD    300
SGDLLLLAHP LHVQLLRNGD NDVKILEDLK YKSIDGDLVG VVGDSWVLKT DPLFVTWHSI    360
KGIKEESHDE IVSALSKDVE SLDSSSITTT ESYFYGKLIA RAARLVLIAE ELNYPDVIPK    420
VRNFLKETIE PWLEGTFSGN GFLHDEKWGG IITQKGSTDA GGDFGFGIYN DHHYHLGYFI    480
YGIAVLTKLD PAWGRKYKPQ AYSIVQDFLN LDTKLNSNYT RLRCFDPYVL HSWAGGLTEF    540
TDGRNQESTS EAVSAYYSAA LMGLAYGDVP LVALGSTLTA LEIEGTKMWW HVKEGGTLYE    600
KEFTQENRVM GVLWSNKRDT GLWFAPAEWK ECRLGIQLLP LAPISEAIFS NVDFVKELVE    660
WTLPALDREG GVGEGWKGFV YALEGVYDNE SALQKIRNLK GFDGGNSLTN LLWWIHSRSD    720
E*                                                                   780
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG5498ACF27.0e-53169719591+
pfam03639Glyco_hydro_815.0e-17268718698+
Gene Ontology
GO TermDescription
GO:0016998cell wall macromolecule catabolic process
GO:0033903endo-1,3(4)-beta-glucanase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAF19265.10587214662AF088188_1 beta-glucan binding protein [Phaseolus vulgaris]
GenBankABB69781.10577185668beta-glucan-binding protein 1 [Medicago truncatula]
GenBankABB69784.10407211668beta-glucan-binding protein 4 [Medicago truncatula]
DDBJBAA11407.10547211668beta-glucan-elicitor receptor [Glycine max]
EMBLCAA71307.10547211668beta-glucan binding protein [Glycine max]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EV2760872224136340
ES8165422913446340
GR9996172654216850
FE6916582294947220
ES816542806337120.86
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01041.1
Arabidopsis lyrata909564
Arabidopsis thalianaAT5G15870.1AT1G18310.1
Brachypodium distachyonBradi4g29390.1
Brassica rapaBra023544Bra008667Bra025916
Carica papayaevm.TU.contig_34602.1evm.model.supercontig_179.46
Capsella rubellaCarubv10000292mCarubv10008525m
Chlamydomonas reinhardtiiCre12.g513400.t1.3.13.714Cre12.g513400.t1.3.13.714Cre12.g513400.t1.3.13.714Cre12.g513400.t1.3.13.714
Citrus clementinaCiclev10011145m
Citrus sinensisorange1.1g042050m
Cucumis sativusCucsa.238220.1Cucsa.238230.1Cucsa.237660.1
Eucalyptus grandisEucgr.I02120.1Eucgr.I02118.1Eucgr.I02113.1Eucgr.L01291.1Eucgr.I02117.1
Eucgr.L01293.1Eucgr.L01292.1Eucgr.L01830.1Eucgr.L01010.1Eucgr.L01290.1
Eucgr.I02115.1Eucgr.I02114.1
Fragaria vescamrna10352.1-v1.0-hybridmrna04398.1-v1.0-hybridmrna25909.1-v1.0-hybridmrna04399.1-v1.0-hybridmrna24770.1-v1.0-hybrid
Glycine maxGlyma19g05550.2Glyma13g07230.2Glyma18g50180.1Glyma18g50220.1Glyma08g26935.1
Glyma08g27000.1Glyma08g26940.1Glyma08g26980.1Glyma13g07240.2Glyma13g07210.2.390.614
Glyma13g07210.2.390.614Glyma03g04290.1Glyma13g07210.2.22.372Glyma13g07210.2.22.372
Gossypium raimondiiGorai.001G082200.1Gorai.007G368000.1
Linum usitatissimumLus10021987Lus10042525Lus10042526
Malus domesticaMDP0000148377MDP0000314562MDP0000855663MDP0000695045MDP0000199068
MDP0000517518MDP0000206670
Manihot esculentacassava4.1_002382m
Medicago truncatulaAC233685_94.1AC233572_18.1AC233685_92.1AC233572_20.1Medtr7g013170.1
AC233572_21.1AC233572_19.1AC233572_25.1AC233685_93.1AC233572_23.1
AC233572_30.1AC233685_76.1AC233572_29.1AC233685_33.1AC233685_46.1
AC233685_68.1AC233685_75.1AC233685_34.1AC233685_74.1Medtr1g079270.1
Medtr7g112730.1
Mimulus guttatusmgv1a002257m
Oryza sativaLOC_Os09g21210.1
Panicum virgatumPavirv00025146mPavirv00045049mPavirv00057587mPavirv00052228m
Physcomitrella patensPp1s16_374V6.1
Phaseolus vulgarisPhvul.004G049300.1Phvul.008G033100.1Phvul.008G033200.1Phvul.008G033000.1Phvul.004G049400.1
Phvul.004G049200.1
Picea abiesMA_10050955g0010MA_28794g0010MA_18557g0010MA_10435904g0010MA_17399g0010
Populus trichocarpaPotri.004G105300.1
Prunus persicappa001976mppa019057mppa023327mppa025396mppa022822m
ppa018031m
Ricinus communis27469.m00016529980.m00017535080.m000014
Setaria italicaSi029037m
Selaginella moellendorffii10094297501
Sorghum bicolorSb02g023660.1Sb10g001930.1
Thellungiella halophilaThhalv10012764mThhalv10003773m
Vitis viniferaGSVIVT01036466001
Volvox carteriVocar20013899m.72.571Vocar20013899m.72.571
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)