y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma13g19670.2
FamilyPL1
Protein PropertiesLength: 367 Molecular Weight: 40855.1 Isoelectric Point: 8.1551
ChromosomeChromosome/Scaffold: 13 Start: 23154699 End: 23157759
DescriptionPectin lyase-like superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
PL1982770
  IVFEVSGTIQLSSYLNVSSHKTIDGRGQRIKLSGKGLRLKECEHVIICNLEFEGGRGHDVDAIQIKPNSKHIWIDRCTLSDFDDGLIDITRESTDITISR
  CHFSQHDKAMLIGADPTHVGDRCMRVTIHHCFFNGTRQRQPRVRFAKVHLYNNYIRNWGIYAVCASVESQIFSQHNIYEA
Full Sequence
Protein Sequence     Length: 367     Download
MGNSHGHRHR KHGNSVPPNT VPPPHKYNPH PTTSNSTMLS LPYTHVDTTL RSLAAQAEGF    60
GRFAIGGLHG PLHPVTSLAD DGPGSLRDAC RRKEPLWIVF EVSGTIQLSS YLNVSSHKTI    120
DGRGQRIKLS GKGLRLKECE HVIICNLEFE GGRGHDVDAI QIKPNSKHIW IDRCTLSDFD    180
DGLIDITRES TDITISRCHF SQHDKAMLIG ADPTHVGDRC MRVTIHHCFF NGTRQRQPRV    240
RFAKVHLYNN YIRNWGIYAV CASVESQIFS QHNIYEAGQK KVAFKYLTEK AADKEVGATG    300
TIRSEGDIFL NGAQKGLMTE DVGCNMFHPS EHYPSWTVEA PTDDLKQILH HCTGWQSLAK    360
PADQTL*                                                              420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00544Pec_lyase_C7.0e-4093273201+
COG3866PelB1.0e-4766343297+
smart00656Amb_all2.0e-66112278179+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABK93648.1013661383unknown [Populus trichocarpa]
GenBankABK96132.1013661386unknown [Populus trichocarpa]
RefSeqXP_002277576.1013641369PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002309435.10403664330predicted protein [Populus trichocarpa]
RefSeqXP_002323433.10403664330predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1pxz_B1.00053e-424731315307A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen
PDB1pxz_A1.00053e-424731315307A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen
PDB1vbl_A5e-27114275130330A Chain A, Structure Of The Thermostable Pectate Lyase Pl 47
PDB3zsc_A3e-269927549246A Chain A, Catalytic Function And Substrate Recognition Of The Pectate Lyase From Thermotoga Maritima
PDB3vmw_A1e-239427646247A Chain A, Catalytic Function And Substrate Recognition Of The Pectate Lyase From Thermotoga Maritima
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DY275282327383630
DW066041301623620
DY289690322253430
JG177860304583610
JG223264280403190
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_027_00219.1.467.641Aquca_027_00219.1.467.641Aquca_027_00219.1.123.302Aquca_027_00219.1.123.302Aquca_027_00219.2.123.302
Aquca_027_00219.2.123.302Aquca_027_00219.3Aquca_027_00219.2.467.633Aquca_027_00219.2.467.633
Arabidopsis lyrata485935478272
Arabidopsis thalianaAT3G55140.1AT3G55140.2AT3G09540.1
Brachypodium distachyonBradi1g22147.1Bradi2g54350.1
Brassica rapaBra029773Bra014772
Capsella rubellaCarubv10014016mCarubv10017857mCarubv10017611m
Citrus clementinaCiclev10012162mCiclev10032073mCiclev10032345mCiclev10012161mCiclev10011951m
Citrus sinensisorange1.1g016742morange1.1g016766morange1.1g017111morange1.1g017716morange1.1g020048m
orange1.1g020121morange1.1g022635morange1.1g023514morange1.1g024841m
Cucumis sativusCucsa.065830.2Cucsa.065830.1
Eucalyptus grandisEucgr.J01160.1Eucgr.A01218.1Eucgr.A01218.2Eucgr.J01160.2
Fragaria vescamrna18180.1-v1.0-hybridmrna23375.1-v1.0-hybrid
Glycine maxGlyma20g38490.1Glyma10g05290.2
Gossypium raimondiiGorai.011G245200.2Gorai.011G245200.1Gorai.006G176400.1
Linum usitatissimumLus10030313Lus10003307Lus10025290Lus10024439
Malus domesticaMDP0000302815MDP0000319235MDP0000259620MDP0000215346MDP0000196711
MDP0000322627
Manihot esculentacassava4.1_010014mcassava4.1_030620m
Mimulus guttatusmgv1a009885mmgv1a008720m
Oryza sativaLOC_Os01g62000.1LOC_Os01g36620.1
Panicum virgatumPavirv00008711mPavirv00047085mPavirv00064103m
Physcomitrella patensPp1s37_38V6.3Pp1s37_38V6.4Pp1s37_38V6.2Pp1s37_38V6.1
Phaseolus vulgarisPhvul.007G009300.1Phvul.007G160100.1
Picea abiesMA_10426401g0010
Populus trichocarpaPotri.006G214400.1Potri.016G080600.1Potri.008G048600.1
Prunus persicappa008409mppa007270m
Ricinus communis29690.m00040929469.m000051
Setaria italicaSi004466mSi010447m
Selaginella moellendorffii93746412910
Sorghum bicolorSb03g039150.1Sb08g004905.1
Thellungiella halophilaThhalv10020972mThhalv10010534m
Vitis viniferaGSVIVT01025593001GSVIVT01005974001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)