y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma13g21240.1
FamilyGT47
Protein PropertiesLength: 506 Molecular Weight: 58286.8 Isoelectric Point: 9.3541
ChromosomeChromosome/Scaffold: 13 Start: 24743928 End: 24747092
DescriptionExostosin family protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT471734540
  EKQFKVFVYEEGELPVFHEGPCASIYSTEGSFIHAIEMNEHFRTRDPKKAHVFFLPFSVVMMVRYVYIRDSHDFGPIKRTVRDYINVIAARYPYWNRSLG
  ADHFMLSCHDWGPEASKFSPYLRKNSIRVLCNANTSEGFDPRKDVSFPEINLQRGPIDGLLGGPSASQRSILAFFAGGIHGPIRPILLEHWEKKDEDIQV
  HQYLPKGVSYYGMLRKSKFCLCPSGYEVASPRVVEAIYTGCVPVLISDHYVPPFSDVLNWKMFSVEVSMKEIPNLKDILMNI
Full Sequence
Protein Sequence     Length: 506     Download
MGSSRWINCC AWRGSEASST MRLFLFMVPL LVLAGFASIK GSTVYNGRDF IAKRYASWSS    60
LITPSNSSSQ TLLDPPSNSS LQTLHQSNET EVFNVSKPGF NLAPANESDE SHPRQKRKRK    120
FSFLDKTEAV LAQARAAIRE AENWNQTQDS DYVPVGPMYW NPKEFHRSYL EMEKQFKVFV    180
YEEGELPVFH EGPCASIYST EGSFIHAIEM NEHFRTRDPK KAHVFFLPFS VVMMVRYVYI    240
RDSHDFGPIK RTVRDYINVI AARYPYWNRS LGADHFMLSC HDWGPEASKF SPYLRKNSIR    300
VLCNANTSEG FDPRKDVSFP EINLQRGPID GLLGGPSASQ RSILAFFAGG IHGPIRPILL    360
EHWEKKDEDI QVHQYLPKGV SYYGMLRKSK FCLCPSGYEV ASPRVVEAIY TGCVPVLISD    420
HYVPPFSDVL NWKMFSVEVS MKEIPNLKDI LMNISPRKYI RMQKRVRQIR RHFEVHSPPK    480
RYDVFHMILH SVWLRRLNFR VLDDQ*                                         540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03016Exostosin4.0e-66172454301+
Gene Ontology
GO TermDescription
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAB08605.1010650110405unnamed protein product [Arabidopsis thaliana]
RefSeqNP_001031828.10106501120515unknown protein [Arabidopsis thaliana]
RefSeqXP_002284018.101725011330PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002326234.101724981327predicted protein [Populus trichocarpa]
RefSeqXP_002528630.10145505209569catalytic, putative [Ricinus communis]
Metabolic Pathways
Pathway NameReactionECProtein Name
xylogalacturonan biosynthesisRXN-9589EC-2.4.2.41xylogalacturonan β-1,3-xylosyltransferase
Transmembrane Domains
StartEnd
2345
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FK01206823012300
GW8648153191885050
GW8951673121344450
FK0120672132945060
CX6439222482585050
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_009_00605.1Aquca_007_00529.3Aquca_007_00529.2Aquca_007_00529.1Aquca_007_00529.4
Aquca_020_00037.1Aquca_013_00915.1Aquca_005_00101.1Aquca_011_00072.1Aquca_001_00331.2
Aquca_001_00331.1Aquca_020_00041.1Aquca_011_00571.1Aquca_009_01038.1Aquca_001_00330.1
Aquca_035_00134.1Aquca_001_00328.1Aquca_020_00333.1Aquca_012_00242.1
Arabidopsis lyrata490811872147493575323060493201
487158326421491427487999325645
488861915839489382
Arabidopsis thalianaAT4G38040.1AT3G07620.1AT5G20260.1AT5G33290.1AT3G42180.1
AT4G16745.2AT4G16745.1AT5G03795.1AT5G11610.1AT4G32790.1
AT5G11130.1AT5G37000.1AT5G25820.1AT5G19670.1AT5G25310.1
AT5G11610.2
Brachypodium distachyonBradi3g06390.1Bradi3g48620.1Bradi1g47867.1Bradi2g44880.1Bradi2g00690.1
Bradi1g54950.1
Brassica rapaBra011803Bra010631Bra040019Bra009509Bra005780
Bra008988Bra002287Bra038949Bra038505Bra008951
Bra034534Bra023309Bra028104Bra009863Bra036554
Bra006550Bra002253Bra009831
Carica papayaevm.model.supercontig_55.7evm.model.supercontig_51.142evm.model.supercontig_89.76evm.model.supercontig_522.3evm.model.supercontig_46.53
evm.model.supercontig_46.52evm.model.supercontig_136.66evm.model.supercontig_5.111evm.model.supercontig_40.36evm.model.supercontig_217.17
evm.model.supercontig_40.35
Capsella rubellaCarubv10004872mCarubv10007826mCarubv10015613mCarubv10004595mCarubv10004583m
Carubv10008022mCarubv10000598mCarubv10003769mCarubv10004339mCarubv10003248m
Carubv10003620mCarubv10000494mCarubv10004511mCarubv10000423mCarubv10000808m
Citrus clementinaCiclev10020851mCiclev10020650mCiclev10020045mCiclev10025728mCiclev10008151m
Ciclev10010628mCiclev10029912mCiclev10019663mCiclev10011407mCiclev10010441m
Ciclev10010549mCiclev10017948mCiclev10007651mCiclev10007698mCiclev10007703m
Ciclev10010873mCiclev10018108m.22.122Ciclev10018108m.22.122Ciclev10018108m.125.191Ciclev10018108m.125.191
Citrus sinensisorange1.1g019788morange1.1g018084morange1.1g017299morange1.1g015235morange1.1g011702m
orange1.1g009454morange1.1g048582morange1.1g048345morange1.1g038832morange1.1g005796m
orange1.1g005775morange1.1g006399morange1.1g013815morange1.1g025504morange1.1g048411m
orange1.1g027723morange1.1g045909morange1.1g039479morange1.1g038978m.142.208orange1.1g038978m.142.208
Cucumis sativusCucsa.340400.1Cucsa.260230.1Cucsa.162550.1Cucsa.316820.1Cucsa.125030.1
Cucsa.249320.1Cucsa.129760.1Cucsa.132400.1Cucsa.084520.1Cucsa.237620.1
Cucsa.235520.1
Eucalyptus grandisEucgr.A02111.1Eucgr.B03578.1Eucgr.H02436.1Eucgr.I02612.1Eucgr.K02385.1
Eucgr.K02411.1Eucgr.C01719.1Eucgr.E03530.1Eucgr.H01381.1Eucgr.E03525.1
Eucgr.C01013.1Eucgr.L02716.1Eucgr.D02098.1Eucgr.L02165.1Eucgr.C01718.1
Eucgr.A01382.1Eucgr.A01384.1Eucgr.C01012.2Eucgr.C01012.1Eucgr.C02925.1
Fragaria vescamrna22764.1-v1.0-hybridmrna20709.1-v1.0-hybridmrna24260.1-v1.0-hybridmrna31120.1-v1.0-hybridmrna11607.1-v1.0-hybrid
mrna30090.1-v1.0-hybridmrna11608.1-v1.0-hybridmrna31119.1-v1.0-hybrid.577.858mrna31119.1-v1.0-hybrid.577.858mrna07685.1-v1.0-hybrid.357.466
mrna07685.1-v1.0-hybrid.357.466mrna08881.1-v1.0-hybridmrna31235.1-v1.0-hybridmrna31119.1-v1.0-hybrid.149.434mrna31119.1-v1.0-hybrid.149.434
mrna08835.1-v1.0-hybrid.332.613mrna08835.1-v1.0-hybrid.332.613mrna11880.1-v1.0-hybridmrna24144.1-v1.0-hybridmrna11879.1-v1.0-hybrid
mrna16788.1-v1.0-hybrid.386.670mrna16788.1-v1.0-hybrid.386.670mrna07353.1-v1.0-hybrid
Glycine maxGlyma19g29020.3Glyma19g29020.2Glyma09g33330.1Glyma01g02630.1Glyma13g32950.1
Glyma13g32950.2Glyma20g15980.2Glyma13g23010.1Glyma13g23020.4Glyma13g23020.3
Glyma16g04391.1Glyma17g11860.2Glyma13g23040.3Glyma13g23040.2Glyma14g14025.1
Glyma17g11870.2Glyma17g11840.2Glyma17g11840.1Glyma01g34990.3Glyma01g34990.2
Glyma17g11880.2Glyma17g15256.1Glyma19g37340.2Glyma19g37340.1Glyma03g34670.1
Glyma13g21270.2Glyma10g07360.1Glyma10g07400.2Glyma17g11850.3Glyma17g11850.2
Glyma17g11850.1Glyma17g27550.3Glyma17g27550.2Glyma17g27550.1Glyma06g08966.2
Glyma06g08966.1Glyma06g16770.2Glyma06g08960.3Glyma06g08960.2Glyma05g35730.4
Glyma05g35730.3Glyma06g07040.2Glyma04g08881.2Glyma04g08881.1Glyma17g32140.2
Glyma04g08870.1Glyma13g23000.1Glyma14g22780.2.334.473Glyma14g22780.2.334.473Glyma09g32716.1
Glyma06g08973.1Glyma14g22780.2.236.335Glyma14g22780.2.236.335Glyma04g38280.2.59.205Glyma04g38280.2.59.205
Glyma04g38280.2.210.303Glyma04g38280.2.210.303Glyma08g03921.1Glyma13g23031.1
Gossypium raimondiiGorai.013G193600.1Gorai.013G193500.2Gorai.013G193500.1Gorai.004G250600.1Gorai.003G036900.1
Gorai.001G189600.1Gorai.009G059200.1Gorai.004G196900.1Gorai.009G059300.1Gorai.004G108000.1
Gorai.013G219000.2Gorai.013G219000.1Gorai.006G159600.1Gorai.010G107300.4Gorai.010G107300.3
Gorai.010G107300.2Gorai.010G107300.1Gorai.002G244600.1Gorai.013G235500.2Gorai.013G235500.1
Gorai.010G060600.1Gorai.001G189500.4Gorai.001G189500.1Gorai.001G007900.2Gorai.001G007900.1
Gorai.009G027100.4Gorai.009G027100.3Gorai.009G027100.2Gorai.009G027100.1Gorai.007G164400.1
Gorai.001G189500.3.99.253Gorai.001G189500.3.99.253Gorai.001G189500.2.192.346Gorai.001G189500.2.192.346Gorai.002G244500.1
Gorai.001G189500.3.253.359Gorai.001G189500.3.253.359Gorai.001G189500.2.346.452Gorai.001G189500.2.346.452
Linum usitatissimumLus10012723Lus10002664Lus10013790Lus10008751Lus10001917
Lus10039980Lus10001958Lus10039142Lus10005186Lus10016058
Lus10002799Lus10000608Lus10027707Lus10011120Lus10023927
Lus10043238Lus10025178Lus10043239Lus10011121Lus10012973
Lus10034951Lus10039981Lus10014424Lus10014425
Malus domesticaMDP0000256891MDP0000460504MDP0000188276MDP0000268076MDP0000142939
MDP0000200586MDP0000174532MDP0000205654MDP0000293604MDP0000128161
MDP0000308560MDP0000207612MDP0000161200MDP0000304216.25.307MDP0000304216.25.307
MDP0000153012MDP0000216342.504.787MDP0000216342.504.787MDP0000216342.504.787MDP0000304216.380.664
MDP0000304216.380.664MDP0000183678MDP0000425449.504.789MDP0000425449.504.789MDP0000434271
MDP0000166871MDP0000190524MDP0000309120MDP0000730619MDP0000606257
MDP0000216342.292.407MDP0000216342.292.407MDP0000216342.292.407MDP0000216342.175.289MDP0000216342.175.289
MDP0000216342.175.289MDP0000148940MDP0000236176MDP0000631221MDP0000304627
MDP0000291668MDP0000167319
Manihot esculentacassava4.1_031633mcassava4.1_024120mcassava4.1_008234mcassava4.1_003271mcassava4.1_028082m
cassava4.1_030944mcassava4.1_028198mcassava4.1_021028mcassava4.1_026933mcassava4.1_003734m
cassava4.1_002819mcassava4.1_002754mcassava4.1_030165mcassava4.1_023849mcassava4.1_024633m
cassava4.1_025682mcassava4.1_030789m
Medicago truncatulaMedtr7g085840.1Medtr5g031480.1AC174330_15.1AC146711_34.1Medtr3g080690.1
Medtr1g061760.1Medtr4g115540.1Medtr4g115530.1Medtr4g115460.1Medtr4g100730.1
AC235664_13.1Medtr8g102840.1Medtr3g106690.1Medtr1g006600.1Medtr4g115530.2
Mimulus guttatusmgv1a006324mmgv1a009927mmgv1a006888mmgv1a007826mmgv1a009659m
mgv1a021626mmgv1a024162mmgv1a006113mmgv1a005355mmgv1a009615m
mgv1a023926mmgv1a009452mmgv1a003254mmgv1a021350mmgv1a006806m
mgv1a004154mmgv1a003679mmgv1a009597mmgv1a002540m
Oryza sativaLOC_Os02g09430.1LOC_Os06g43160.1LOC_Os01g45350.1LOC_Os04g01930.1LOC_Os02g39960.1
LOC_Os01g01780.1LOC_Os07g09050.1LOC_Os06g46690.1LOC_Os06g07887.1LOC_Os07g09050.2
Panicum virgatumPavirv00010813mPavirv00040849mPavirv00069857mPavirv00065138mPavirv00062692m
Pavirv00032235mPavirv00052337mPavirv00033421mPavirv00055383m
Physcomitrella patensPp1s306_31V6.1Pp1s53_231V6.1Pp1s309_76V6.1Pp1s308_9V6.1Pp1s354_12V6.1
Pp1s112_202V6.1Pp1s92_122V6.1Pp1s92_112V6.1
Phaseolus vulgarisPhvul.006G201500.1Phvul.002G145100.1Phvul.001G112000.1Phvul.003G169700.1Phvul.003G169800.1
Phvul.003G169900.1Phvul.001G050100.1Phvul.003G169600.1Phvul.003G222300.1Phvul.001G184500.1
Phvul.007G225300.1Phvul.001G073700.1Phvul.004G169700.1Phvul.009G157700.1Phvul.002G310300.2
Phvul.002G310300.1Phvul.009G109400.1Phvul.009G109300.1Phvul.009G091800.1
Picea abiesMA_10432435g0010MA_61350g0010MA_101422g0010MA_61030g0020MA_10437120g0010
MA_125709g0010MA_1166335g0010MA_20132g0010MA_10429289g0010MA_932134g0010
MA_10429289g0020MA_150461g0010MA_217947g0010MA_211090g0010MA_93211g0010
Populus trichocarpaPotri.001G072500.1Potri.019G036500.1Potri.019G036500.2Potri.007G058400.1Potri.005G147500.1
Potri.007G117600.2Potri.007G117600.1Potri.015G087900.1Potri.007G058400.2Potri.014G170900.1
Potri.005G147500.2Potri.018G124800.1Potri.018G025400.1Potri.007G116800.1Potri.007G116800.2
Potri.018G085400.3Potri.018G085400.2Potri.018G085400.1Potri.007G118100.1Potri.018G125000.1
Potri.006G064900.1Potri.006G064700.1Potri.003G079000.1Potri.018G043700.2Potri.018G043700.1
Potri.006G118000.2Potri.006G118000.1Potri.014G171100.1Potri.018G124900.1Potri.018G025200.1
Potri.006G064600.1Potri.006G239000.1Potri.018G085500.1Potri.006G064800.1Potri.006G238900.4
Potri.006G238900.3Potri.006G238900.2Potri.006G238900.1Potri.006G239000.2
Prunus persicappa024657mppa015806mppa008586mppa024503mppa023392m
ppa1027150mppa007120mppa006842mppa003859mppa002395m
ppa004757mppa002387mppa017740mppa001571mppa014750m
ppa008342mppa002755mppa017605mppa015603mppa025338m
ppa017492mppa022144mppa012520mppa022127m
Ricinus communis30128.m00871530072.m00098529826.m00073430101.m00038729848.m004601
29912.m00546630005.m00127630005.m00127529848.m00460029815.m000494
29794.m00337929912.m00546528543.m00038628543.m00038729794.m003378.323.474
29794.m003378.323.47429794.m003378.474.55229794.m003378.474.552
Setaria italicaSi017359mSi004108mSi004162mSi019424mSi029368m
Si007869m
Selaginella moellendorffii105852172637106537136816229884
23041092752
Sorghum bicolorSb04g005890.1Sb03g008610.1Sb04g025885.1Sb10g005120.1Sb03g029210.1
Sb02g005180.1
Thellungiella halophilaThhalv10025280mThhalv10020696mThhalv10016080mThhalv10004121mThhalv10002345m
Thhalv10004530mThhalv10024835mThhalv10024833mThhalv10015371mThhalv10024793m
Thhalv10013187mThhalv10013399mThhalv10003790mThhalv10003789mThhalv10027719m
Thhalv10013011mThhalv10028139m
Vitis viniferaGSVIVT01001143001GSVIVT01022479001GSVIVT01003953001GSVIVT01012525001GSVIVT01006274001
GSVIVT01030133001GSVIVT01035880001GSVIVT01035881001GSVIVT01012820001GSVIVT01030134001
GSVIVT01033738001GSVIVT01012806001GSVIVT01012808001GSVIVT01012807001GSVIVT01015330001
GSVIVT01035630001GSVIVT01015329001GSVIVT01012805001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)