y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma13g23190.1
FamilyGH79
Protein PropertiesLength: 525 Molecular Weight: 57593 Isoelectric Point: 8.5476
ChromosomeChromosome/Scaffold: 13 Start: 26640141 End: 26643792
Descriptionglucuronidase 3
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH79525180
  DDSVCATLDWWPPQKCDYGKCSWGHASLLNLDLNNKILLNAVKAFSPLKIRLGGTLQDKVMYGTEDCRQPCTPFVLNANEMFGFTQGCLPMYRWDELNSF
  FQKAGAKVVFGLNALAGKSMKSGSAVGPWNYTNAESLIRYTVRKKYTIHGWELGNELCGSGIGASVAADQYASDVAALRNIVENAYRGIEPKPLVIAPGG
  FFDSDWFKEFISKSGKSADVITHHIYNLGPGVDDHLTEKILDPSYLDGEANTFSSLKGILQSSSTSVKSWVGEAGGAYNSGHHLVSDAFVYSFWYLDQLG
  MSAVYDTRTYCRQSLIGGNYGLLNTSTFVPNPDYYSALLWHRLMGGRVLLTTFYGTKKIRTYAHCAKESKGITILVLNLDNSTTVQVNVALKFNKLPYRR
  VGEPARREYHLTAPDRNLHSQTMLLNGKMLSVNSAGEIPPLEPLYVNSRKPIIVGPLSIVFAHIPNV
Full Sequence
Protein Sequence     Length: 525     Download
MGSQIRLLGL CLWMYLSSLS FIGAGAVYGR EGEVVKGIVL VHGKTAIGRI DDDSVCATLD    60
WWPPQKCDYG KCSWGHASLL NLDLNNKILL NAVKAFSPLK IRLGGTLQDK VMYGTEDCRQ    120
PCTPFVLNAN EMFGFTQGCL PMYRWDELNS FFQKAGAKVV FGLNALAGKS MKSGSAVGPW    180
NYTNAESLIR YTVRKKYTIH GWELGNELCG SGIGASVAAD QYASDVAALR NIVENAYRGI    240
EPKPLVIAPG GFFDSDWFKE FISKSGKSAD VITHHIYNLG PGVDDHLTEK ILDPSYLDGE    300
ANTFSSLKGI LQSSSTSVKS WVGEAGGAYN SGHHLVSDAF VYSFWYLDQL GMSAVYDTRT    360
YCRQSLIGGN YGLLNTSTFV PNPDYYSALL WHRLMGGRVL LTTFYGTKKI RTYAHCAKES    420
KGITILVLNL DNSTTVQVNV ALKFNKLPYR RVGEPARREY HLTAPDRNLH SQTMLLNGKM    480
LSVNSAGEIP PLEPLYVNSR KPIIVGPLSI VFAHIPNVLL SACS*                    540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03662Glyco_hydro_79n035351319+
Gene Ontology
GO TermDescription
GO:0016020membrane
GO:0016798hydrolase activity, acting on glycosyl bonds
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACU20377.1015241525unknown [Glycine max]
EMBLCAN81917.1015231554hypothetical protein [Vitis vinifera]
EMBLCBI25561.1085231532unnamed protein product [Vitis vinifera]
RefSeqXP_002263173.1015235558PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002324603.10375241506predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3vo0_A0.0000001146439122409A Chain A, Crystal Structure Of Tryptophan Synthase Alpha-subunit From The Psychrophile Shewanella Frigidimarina K14-2
PDB3vnz_A0.0000001146439122409A Chain A, Crystal Structure Of Tryptophan Synthase Alpha-subunit From The Psychrophile Shewanella Frigidimarina K14-2
PDB3vny_A0.0000001146439122409A Chain A, Crystal Structure Of Beta-Glucuronidase From Acidobacterium Capsulatum
Transmembrane Domains
StartEnd
729
Signal Peptide
Cleavage Site
29
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO80613234513450
HO7998863062205250
CO9820742642565190
FK0193362341874200
DT548485284923740
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_083_00009.1Aquca_002_00770.2Aquca_002_00771.1Aquca_002_00770.1Aquca_002_00770.3
Aquca_002_00771.4Aquca_002_00771.3Aquca_002_00770.4Aquca_002_00771.2.202.436Aquca_002_00771.2.202.436
Aquca_002_00771.2.40.206Aquca_002_00771.2.40.206
Arabidopsis lyrata493582496280350042497509
Arabidopsis thalianaAT5G34940.2AT5G07830.1AT5G61250.2AT5G61250.1AT5G34940.3
AT5G34940.1
Brachypodium distachyonBradi1g47760.1Bradi3g54370.1Bradi1g70300.1Bradi4g03680.1Bradi4g03680.2
Bradi1g70300.3
Brassica rapaBra038945Bra012974Bra009310
Carica papayaevm.model.supercontig_277.3evm.model.supercontig_187.5evm.model.supercontig_51.106evm.model.supercontig_51.104evm.model.supercontig_51.103
Capsella rubellaCarubv10004531mCarubv10028123mCarubv10002679m
Citrus clementinaCiclev10007919mCiclev10010401mCiclev10019606mCiclev10019304mCiclev10033641m
Citrus sinensisorange1.1g008951morange1.1g037212morange1.1g008762morange1.1g009131morange1.1g009122m
orange1.1g009113morange1.1g009102morange1.1g008834morange1.1g041499morange1.1g013838m
orange1.1g014399morange1.1g019695m
Cucumis sativusCucsa.113020.5Cucsa.113020.2Cucsa.113020.1Cucsa.132500.1Cucsa.198040.1
Cucsa.284640.1Cucsa.201230.1Cucsa.034470.1Cucsa.252720.2Cucsa.252720.1
Eucalyptus grandisEucgr.C02742.1Eucgr.K02497.1Eucgr.B00567.2Eucgr.B00567.1Eucgr.G02460.1
Eucgr.C04395.1Eucgr.B03174.1Eucgr.C02742.2Eucgr.C04395.2Eucgr.C02741.1
Eucgr.C02740.1
Fragaria vescamrna30784.1-v1.0-hybridmrna26075.1-v1.0-hybridmrna11598.1-v1.0-hybridmrna11600.1-v1.0-hybrid
Glycine maxGlyma09g11990.2Glyma09g11990.1Glyma15g23550.1Glyma17g11670.1Glyma04g32745.2
Glyma04g32745.1Glyma05g00663.1Glyma17g08444.1Glyma06g21551.2Glyma06g21551.1
Glyma02g12760.1Glyma02g12740.1Glyma09g11990.3Glyma05g00663.2Glyma02g12740.2
Glyma06g40075.1Glyma10g27494.1
Gossypium raimondiiGorai.004G108900.2Gorai.004G108900.1Gorai.008G196400.1Gorai.010G059600.1Gorai.006G267500.2
Gorai.006G267500.1Gorai.004G293000.2Gorai.011G285000.1Gorai.011G271100.1Gorai.004G293000.1
Gorai.N016700.1Gorai.011G285200.1Gorai.N009300.1Gorai.010G059600.2Gorai.006G004300.1
Gorai.009G305800.1Gorai.008G196400.2Gorai.006G004400.1Gorai.N021000.1Gorai.006G004500.1
Gorai.010G059600.3Gorai.N009100.1Gorai.006G004200.1Gorai.N009200.1.197.494Gorai.N009200.1.197.494
Gorai.011G284500.1.38.235Gorai.011G284500.1.38.235Gorai.006G021700.1.57.271Gorai.006G021700.1.57.271Gorai.011G284500.1.237.471
Gorai.011G284500.1.237.471Gorai.N009200.1.41.200Gorai.N009200.1.41.200Gorai.011G271700.1Gorai.006G021700.1.269.391
Gorai.006G021700.1.269.391
Linum usitatissimumLus10008823Lus10038109Lus10008038Lus10003468Lus10015737
Lus10021652Lus10034707Lus10001923Lus10004664Lus10036963
Lus10037110Lus10037109Lus10036962Lus10001952
Malus domesticaMDP0000088659MDP0000189628MDP0000242071MDP0000199066MDP0000252327
MDP0000248683
Manihot esculentacassava4.1_032464mcassava4.1_005011mcassava4.1_031502mcassava4.1_005078mcassava4.1_005072m
cassava4.1_004963mcassava4.1_021602mcassava4.1_008768m
Medicago truncatulaMedtr4g116070.1Medtr5g043710.1Medtr4g116040.1Medtr8g091920.1
Mimulus guttatusmgv1a026019mmgv1a004063mmgv1a026758mmgv1a004017mmgv1a004194m
mgv1a008019mmgv1a008017mmgv1a025097mmgv1a011158m
Oryza sativaLOC_Os06g08090.2LOC_Os06g08090.1LOC_Os02g55870.1LOC_Os12g38920.2LOC_Os12g38920.1
LOC_Os03g11320.2LOC_Os03g11320.1LOC_Os07g40740.1
Panicum virgatumPavirv00018673mPavirv00048771mPavirv00008589mPavirv00009033mPavirv00009032m
Pavirv00012019mPavirv00030038mPavirv00060468mPavirv00035109mPavirv00018674m
Pavirv00033639m
Physcomitrella patensPp1s118_67V6.1Pp1s90_137V6.1Pp1s121_77V6.1Pp1s181_80V6.1
Phaseolus vulgarisPhvul.009G212400.1Phvul.003G186600.2Phvul.003G186600.1Phvul.003G171800.1Phvul.002G081000.1
Phvul.003G171800.2Phvul.002G087100.3Phvul.002G087100.2Phvul.002G087100.1
Picea abiesMA_77698g0010MA_10433885g0020MA_93036g0020MA_854085g0010MA_71853g0010
MA_93036g0010.60.248MA_93036g0010.60.248MA_343625g0010MA_269826g0010MA_10433885g0010
MA_93036g0010.317.479MA_93036g0010.317.479
Populus trichocarpaPotri.018G121500.1Potri.018G024200.1Potri.006G062200.2Potri.006G062200.1Potri.010G160800.2
Potri.010G160800.1Potri.010G160800.3Potri.015G049100.4Potri.015G049100.3Potri.015G049100.2
Potri.015G049100.1Potri.018G121500.3Potri.018G121500.2Potri.015G049100.5Potri.010G160800.4
Potri.015G049100.6
Prunus persicappa003883mppa019445mppa003804mppa003813mppa025624m
Ricinus communis29848.m00459029720.m00013730138.m00401530174.m00914230174.m009143
Setaria italicaSi016855mSi006147mSi035072mSi035071mSi021698m
Selaginella moellendorffii10593113310032458
Sorghum bicolorSb04g036200.1Sb10g005260.1Sb01g043180.1Sb08g019250.1
Thellungiella halophilaThhalv10013186mThhalv10003960mThhalv10003449m
Vitis viniferaGSVIVT01012851001GSVIVT01007918001GSVIVT01012184001GSVIVT01035950001.36.452GSVIVT01035950001.36.452
GSVIVT01035950001.521.878GSVIVT01035950001.521.878
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)