y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma13g26700.1
FamilyGH2
Protein PropertiesLength: 1122 Molecular Weight: 126569 Isoelectric Point: 6.118
ChromosomeChromosome/Scaffold: 13 Start: 29892776 End: 29902554
Descriptionglycoside hydrolase family 2 protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH2929860
  VKSLSGYWKFFIADSPNNVPTYFYESEFQDSGWKTLPVPSNWQLHGFDTPIYTNVVYPFPLDPPFIPVENPTGCYRTYFHIPKEWEGRRVLLHFEAVDSA
  FCAWINGHPVGYSQDSRLPAEFEITDFCHPCGSDLKNVLAVQVFRWCDGSYLEDQDQWRLSGIHRDVLLMAKPEVFITDYFFKSNLAEDFSCAEIMVEVK
  IDRLQETSKDNVLTNYSIEATLFDSGSWYTSDGNPDLLSSNVADIKLQSSSAPAQPLGFHGYVLTGKLKSPKLWSAEKPYLYTLVVVLKDRSGRIVDCES
  CPVGFRKVSKAHKQLLVNGHAVVIRGVNRHEHHPQVGKANIESCMIKDLVLMKQNNINAVRNSHYPQHPRWYELCDLFGMYMIDEANIETHHFDYSKHLK
  HPTMEPKWATSMLDRVIGMVERDKNHTCIISWSLGNESGFGTNHFALAGWIRGRDSSRVLHYEGGGSRTPCTDIVCPMYMRVWDMVKIANDPTETRPLIL
  CEYSHAMGNSNGNLHIYWEAIDNTFGLQGGFIWDWVDQALVKVYEDGTKHWAYGGEFGDVPNDLNFCLNGLTFPDRTPHPVLHEVKYLYQPIKVALKEGK
  LEIKNTHFFQTTEGLEFSWSISADGYNLGSGLLGLVPIKPQSSHAVDWQSGPWYSLWASTDEEELFLTITAKLLNSTRWVEAGHIVSSAQVQLPTRRNIA
  PHVIDINGGTLVAETLGDTIVVKQQDAWDLTLNTKTGLVESWKVKGVHVMKKGILPCFWRAPIDNDKGGGSASYLSRWKAAGMDCLHFITESCSVQNITE
  NSVRILVVFLGVTKGEDGSLSNQDKSKVLFTTEMAYTIYASGDVIIECNVKPNPDLPPLPRVGIELNVEKSLDQVTWYGRGPFECYPDRKAAALV
Full Sequence
Protein Sequence     Length: 1122     Download
MMASSSLVVV GSLHLTSQNG YKVWEDPSFI KWRKRDPHVT LHCHESLEGS LKYWYQRNKV    60
DFLASQSAVW NDDAVQGSLD CAAFWVKDLP FVKSLSGYWK FFIADSPNNV PTYFYESEFQ    120
DSGWKTLPVP SNWQLHGFDT PIYTNVVYPF PLDPPFIPVE NPTGCYRTYF HIPKEWEGRR    180
VLLHFEAVDS AFCAWINGHP VGYSQDSRLP AEFEITDFCH PCGSDLKNVL AVQVFRWCDG    240
SYLEDQDQWR LSGIHRDVLL MAKPEVFITD YFFKSNLAED FSCAEIMVEV KIDRLQETSK    300
DNVLTNYSIE ATLFDSGSWY TSDGNPDLLS SNVADIKLQS SSAPAQPLGF HGYVLTGKLK    360
SPKLWSAEKP YLYTLVVVLK DRSGRIVDCE SCPVGFRKVS KAHKQLLVNG HAVVIRGVNR    420
HEHHPQVGKA NIESCMIKDL VLMKQNNINA VRNSHYPQHP RWYELCDLFG MYMIDEANIE    480
THHFDYSKHL KHPTMEPKWA TSMLDRVIGM VERDKNHTCI ISWSLGNESG FGTNHFALAG    540
WIRGRDSSRV LHYEGGGSRT PCTDIVCPMY MRVWDMVKIA NDPTETRPLI LCEYSHAMGN    600
SNGNLHIYWE AIDNTFGLQG GFIWDWVDQA LVKVYEDGTK HWAYGGEFGD VPNDLNFCLN    660
GLTFPDRTPH PVLHEVKYLY QPIKVALKEG KLEIKNTHFF QTTEGLEFSW SISADGYNLG    720
SGLLGLVPIK PQSSHAVDWQ SGPWYSLWAS TDEEELFLTI TAKLLNSTRW VEAGHIVSSA    780
QVQLPTRRNI APHVIDINGG TLVAETLGDT IVVKQQDAWD LTLNTKTGLV ESWKVKGVHV    840
MKKGILPCFW RAPIDNDKGG GSASYLSRWK AAGMDCLHFI TESCSVQNIT ENSVRILVVF    900
LGVTKGEDGS LSNQDKSKVL FTTEMAYTIY ASGDVIIECN VKPNPDLPPL PRVGIELNVE    960
KSLDQVTWYG RGPFECYPDR KAAALVAVYE HNVSELHVPY IVPGESSGRA DVRWATFRNK    1020
DAFGIYASKY GSSPPMQMSA SYYSTSELDR ATHNEELIEG DSIEIHLDHK HMGLGGDDSW    1080
SPCVHEQYLI PPVPYSFSVR LCPVNPATSG HDIYKSQFQN S*                       1140
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
smart01038Bgal_small_N8.0e-938171101286+
pfam02836Glyco_hydro_2_C1.0e-100404684291+
COG3250LacZ1.0e-15592985902+
PRK09525lacZ09011031053+
PRK10340ebgA09311051017+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0004565beta-galactosidase activity
GO:0005975carbohydrate metabolic process
GO:0009341beta-galactosidase complex
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqXP_002266400.109112041114PREDICTED: hypothetical protein isoform 1 [Vitis vinifera]
RefSeqXP_002266434.109112041115PREDICTED: hypothetical protein isoform 2 [Vitis vinifera]
RefSeqXP_002299206.10181120131110predicted protein [Populus trichocarpa]
RefSeqXP_002303929.109112041113predicted protein [Populus trichocarpa]
RefSeqXP_002513059.102112011110beta-galactosidase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3muy_409211025110211 Chain 1, E. Coli (Lacz) Beta-Galactosidase (R599a)
PDB3muy_309211025110211 Chain 1, E. Coli (Lacz) Beta-Galactosidase (R599a)
PDB3muy_209211025110211 Chain 1, E. Coli (Lacz) Beta-Galactosidase (R599a)
PDB3muy_109211025110211 Chain 1, E. Coli (Lacz) Beta-Galactosidase (R599a)
PDB1jz7_D0921102511021A Chain A, E. Coli (Lacz) Beta-Galactosidase In Complex With Galactose
Metabolic Pathways
Pathway NameReactionECProtein Name
lactose degradation IIIBETAGALACTOSID-RXNEC-3.2.1.23β-galactosidase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO8042743851345170
GR85894527484611190
HO79133527212720
HO791335862713560
HO804274505085560.00000000000004
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00605.1Aquca_014_00605.2
Arabidopsis lyrata485844
Arabidopsis thalianaAT3G54440.1AT3G54440.2AT3G54440.3
Brachypodium distachyonBradi2g61010.1
Brassica rapaBra014816
Carica papayaevm.model.supercontig_540.3
Capsella rubellaCarubv10019396m
Chlamydomonas reinhardtiiCre08.g379450.t1.3
Citrus clementinaCiclev10030068mCiclev10027821m
Citrus sinensisorange1.1g004315morange1.1g004363morange1.1g006933morange1.1g023943morange1.1g023667m
orange1.1g022918morange1.1g007038m
Cucumis sativusCucsa.307940.11Cucsa.307940.1Cucsa.307940.12
Eucalyptus grandisEucgr.J01181.1
Fragaria vescamrna14286.1-v1.0-hybrid
Glycine maxGlyma15g37670.1
Gossypium raimondiiGorai.010G216500.1
Linum usitatissimumLus10024155Lus10039520Lus10039519
Manihot esculentacassava4.1_002723m
Medicago truncatulaMedtr8g039160.1
Mimulus guttatusmgv1a000801m
Oryza sativaLOC_Os01g72340.1
Panicum virgatumPavirv00010284mPavirv00069653m
Physcomitrella patensPp1s130_43V6.1
Phaseolus vulgarisPhvul.011G206800.1
Picea abiesMA_10429668g0010
Populus trichocarpaPotri.003G196500.1Potri.003G196500.2Potri.001G027400.1
Prunus persicappa000508mppa000532m
Ricinus communis30131.m007196
Setaria italicaSi000118mSi000119m
Selaginella moellendorffii181800
Sorghum bicolorSb03g046050.2Sb03g046050.1
Thellungiella halophilaThhalv10010080m
Vitis viniferaGSVIVT01013489001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny