y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma13g27480.1
FamilyCBM53
Protein PropertiesLength: 1150 Molecular Weight: 130002 Isoelectric Point: 5.1454
ChromosomeChromosome/Scaffold: 13 Start: 30660060 End: 30670615
Descriptionstarch synthase 3
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM532653481.8e-30
  QDIELFLNKNLSTLSEEPDILIMGAFNDWKWKSFSIRLNKLHLKGDWWSCQLYVPKEAYKVDFVFFNGQNVYDNNDQKDFCIPV
CBM534425292.5e-33
  IRLYYNRSSGPLANANEIWIHGGHNNWKYGLSIVERLVKSVLKGGEWWYADVVVPDQALVLDWVFADGPPKKAVVYDNNRKQDFHAIV
CBM536016892.3e-33
  GSTVTIFYNPSNTNLNGKPEVWFRCSFNRWSHRNGPLPPQRMLPAENGTHVKASFKVPLDAYMMDFVFSESEHGGVFDNKFGMDYHIPV
GT570011430
  HIIHIAVEMAPIAKVGGLGDVVTSLSRAVQDLNHNVDIILPKYDCLNLSNVKDFDYHKSYSWGGTEIKVWHGKVEGLSVYFLEPQNGFFQVGCVYGRGND
  GERFGFFCHAALEFLLQNGFHPDIIHCHDWSSAPVAWLFKDNYAHYGLSKARVVFTIHNLEFGAHSIGKAMAYADKATTVSPTYSREIAGNPVIAPHLHK
  FHGIINGIDPDIWDPYNDKFIPVSYSSENVVEGKRASKETLQQRLSLKKADLPLVGIITRLTHQKGIHLIKHAIWRTLERGGQVVLLGSAPDPRIQNDFV
  NLANELHSAHHDRARLCLAYDEPLSHLIYAGADFILVPSIFEPCGLTQLTAMRYGSIPVVRKTGGLYDTVFDVDHDKDRAQAQGLEPNGFSFDGADTGGV
  DYALNRAISAWYEGRDWFNSLCKRVMEQDWSWNRPALDYLELYH
Full Sequence
Protein Sequence     Length: 1150     Download
MEMSMQLNCK TVFPYRGGYI CSPCKAGWGV SFVRASADFS RKRQQKKVSV ARTKGTSGKG    60
FVPSKKNTRM KKGDTLTSVV SEVSGGDKKQ TVEVNVDDTD KEGELEFSQE EKFEAVDRID    120
ENVGDVGDLS LLDETVGELS LLDESNQATI SVFDEDVEVL ESWKEEFPYN GGVGIVEDSS    180
EEGLLESAEI DENVKDTDTD GDITEEAVEE SSSADDDRIN EEAAGLLKLE LEANQRRQEI    240
ERIAEEKLSQ GIKLFVYPPV VKPDQDIELF LNKNLSTLSE EPDILIMGAF NDWKWKSFSI    300
RLNKLHLKGD WWSCQLYVPK EAYKVDFVFF NGQNVYDNND QKDFCIPVDG GMDALAFEDF    360
LLEEKRKELE ELARAQAERE RQAEEQRRIE ADRAAKEEDR ARAKAEIGKM RETLPQLLKN    420
AVKSVDNVWH IEPSEFKGKD LIRLYYNRSS GPLANANEIW IHGGHNNWKY GLSIVERLVK    480
SVLKGGEWWY ADVVVPDQAL VLDWVFADGP PKKAVVYDNN RKQDFHAIVP GAIPDEQYWV    540
EEEQLIYRKF QEERRLREDA IRAKAEKTAQ MKAETKERTL KGFLLSQKHI VFTDPLDVQA    600
GSTVTIFYNP SNTNLNGKPE VWFRCSFNRW SHRNGPLPPQ RMLPAENGTH VKASFKVPLD    660
AYMMDFVFSE SEHGGVFDNK FGMDYHIPVF GSIAKEPPLH IIHIAVEMAP IAKVGGLGDV    720
VTSLSRAVQD LNHNVDIILP KYDCLNLSNV KDFDYHKSYS WGGTEIKVWH GKVEGLSVYF    780
LEPQNGFFQV GCVYGRGNDG ERFGFFCHAA LEFLLQNGFH PDIIHCHDWS SAPVAWLFKD    840
NYAHYGLSKA RVVFTIHNLE FGAHSIGKAM AYADKATTVS PTYSREIAGN PVIAPHLHKF    900
HGIINGIDPD IWDPYNDKFI PVSYSSENVV EGKRASKETL QQRLSLKKAD LPLVGIITRL    960
THQKGIHLIK HAIWRTLERG GQVVLLGSAP DPRIQNDFVN LANELHSAHH DRARLCLAYD    1020
EPLSHLIYAG ADFILVPSIF EPCGLTQLTA MRYGSIPVVR KTGGLYDTVF DVDHDKDRAQ    1080
AQGLEPNGFS FDGADTGGVD YALNRAISAW YEGRDWFNSL CKRVMEQDWS WNRPALDYLE    1140
LYHAARKAE*                                                           1200
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02316PLN023166.0e-6554693143+
TIGR02095glgA2.0e-1586991145489+
PRK00654glgA2.0e-1696991148487+
PLN02316PLN0231602481147900+
cd03791GT1_Glycogen_synthase_DULL1_like07001143489+
Gene Ontology
GO TermDescription
GO:0009058biosynthetic process
GO:2001070starch binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAF49176.101114911165starch synthase III [Phaseolus vulgaris]
EMBLCAB40374.101114911147Starch synthase isoform SS III [Vigna unguiculata]
RefSeqXP_002269011.10451147321140PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002305571.102081147631017predicted protein [Populus trichocarpa]
RefSeqXP_002518476.1048114711058starch synthase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3d1j_A069911431474A Chain A, Crystal Structure Of E.Coli Gs Mutant Dmgs(C7s;c40
PDB3guh_A069911431474A Chain A, Crystal Structure Of E.Coli Gs Mutant Dmgs(C7s;c40
PDB2r4u_A069911431474A Chain A, Crystal Structure Of E.Coli Gs Mutant Dmgs(C7s;c40
PDB2r4t_A069911431474A Chain A, Crystal Structure Of E.Coli Gs Mutant Dmgs(C7s;c40
PDB2qzs_A069911431474A Chain A, Crystal Structure Of Wild-Type E.Coli Gs In Complex With Adp And Glucose(Wtgsb)
Metabolic Pathways
Pathway NameReactionECProtein Name
starch biosynthesisGLYCOGENSYN-RXNEC-2.4.1.21starch synthase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7780036902479360
HO79475857058111500
HO65139241273611470
HO7947581092483520.004
HO7947581074325361.9
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_005_00047.2.247.331Aquca_005_00047.2.247.331Aquca_005_00047.2.247.331Aquca_005_00047.1.247.331Aquca_005_00047.1.247.331
Aquca_005_00047.1.247.331Aquca_005_00047.1.423.513Aquca_005_00047.1.423.513Aquca_005_00047.1.423.513Aquca_005_00047.2.581.669
Aquca_005_00047.2.581.669Aquca_005_00047.2.581.669Aquca_005_00047.1.585.673Aquca_005_00047.1.585.673Aquca_005_00047.1.585.673
Aquca_005_00047.2.423.509Aquca_005_00047.2.423.509Aquca_005_00047.2.423.509
Arabidopsis lyrata312200.125.208312200.125.208312200.125.208312200.474.562312200.474.562
312200.474.562312200.300.401312200.300.401312200.300.401
Arabidopsis thalianaAT1G11720.2.206.289AT1G11720.2.206.289AT1G11720.2.206.289AT1G11720.1.154.237AT1G11720.1.154.237
AT1G11720.1.154.237AT1G11720.2.381.475AT1G11720.2.381.475AT1G11720.2.381.475AT1G11720.1.329.423
AT1G11720.1.329.423AT1G11720.1.329.423AT1G11720.2.548.636AT1G11720.2.548.636AT1G11720.2.548.636
AT1G11720.1.496.584AT1G11720.1.496.584AT1G11720.1.496.584
Brachypodium distachyonBradi5g22310.1.403.486Bradi5g22310.1.403.486Bradi5g22310.1.403.486Bradi3g15027.1.835.918Bradi3g15027.1.835.918
Bradi3g15027.1.835.918Bradi5g22310.1.577.667Bradi5g22310.1.577.667Bradi5g22310.1.577.667Bradi5g22310.1.739.827
Bradi5g22310.1.739.827Bradi5g22310.1.739.827
Brassica rapaBra016818.430.514Bra016818.430.514Bra016818.430.514Bra019836.120.208Bra016818.605.694
Bra016818.605.694Bra016818.605.694Bra016818.767.855Bra016818.767.855Bra016818.767.855
Carica papayaevm.model.supercontig_152.17.311.394evm.model.supercontig_152.17.311.394evm.model.supercontig_152.17.311.394evm.model.supercontig_152.17.486.575evm.model.supercontig_152.17.486.575
evm.model.supercontig_152.17.486.575evm.model.supercontig_152.17.647.735evm.model.supercontig_152.17.647.735evm.model.supercontig_152.17.647.735
Capsella rubellaCarubv10011175m.206.289Carubv10011175m.206.289Carubv10011175m.206.289Carubv10011175m.381.474Carubv10011175m.381.474
Carubv10011175m.381.474Carubv10011175m.547.635Carubv10011175m.547.635Carubv10011175m.547.635
Chlamydomonas reinhardtiiCre06.g282000.t2.1.660.749Cre06.g282000.t2.1.660.749Cre06.g282000.t1.3.696.785Cre06.g282000.t1.3.696.785Cre06.g282000.t2.1.308.399
Cre06.g282000.t2.1.308.399Cre06.g282000.t1.3.344.435Cre06.g282000.t1.3.344.435
Citrus clementinaCiclev10014319m.155.243Ciclev10014319m.155.243
Citrus sinensisorange1.1g046057m.276.359orange1.1g046057m.276.359orange1.1g046057m.276.359orange1.1g046057m.452.540orange1.1g046057m.452.540
orange1.1g046057m.452.540orange1.1g046057m.612.700orange1.1g046057m.612.700orange1.1g046057m.612.700
Cucumis sativusCucsa.085800.2.269.352Cucsa.085800.2.269.352Cucsa.085800.2.269.352Cucsa.085800.1.269.352Cucsa.085800.1.269.352
Cucsa.085800.1.269.352Cucsa.085800.2.443.534Cucsa.085800.2.443.534Cucsa.085800.2.443.534Cucsa.085800.1.443.534
Cucsa.085800.1.443.534Cucsa.085800.1.443.534Cucsa.085800.2.607.694Cucsa.085800.2.607.694Cucsa.085800.2.607.694
Cucsa.085800.1.607.694Cucsa.085800.1.607.694Cucsa.085800.1.607.694
Eucalyptus grandisEucgr.D01324.4.304.386Eucgr.D01324.4.304.386Eucgr.D01324.4.304.386Eucgr.D01324.3.304.386Eucgr.D01324.3.304.386
Eucgr.D01324.3.304.386Eucgr.D01324.2.304.386Eucgr.D01324.2.304.386Eucgr.D01324.2.304.386Eucgr.D01324.1.309.391
Eucgr.D01324.1.309.391Eucgr.D01324.1.309.391Eucgr.D01324.4.478.567Eucgr.D01324.4.478.567Eucgr.D01324.4.478.567
Eucgr.D01324.3.478.567Eucgr.D01324.3.478.567Eucgr.D01324.3.478.567Eucgr.D01324.2.478.567Eucgr.D01324.2.478.567
Eucgr.D01324.2.478.567Eucgr.D01324.1.483.572Eucgr.D01324.1.483.572Eucgr.D01324.1.483.572Eucgr.D01324.4.639.727
Eucgr.D01324.4.639.727Eucgr.D01324.4.639.727Eucgr.D01324.3.639.727Eucgr.D01324.3.639.727Eucgr.D01324.3.639.727
Eucgr.D01324.2.639.727Eucgr.D01324.2.639.727Eucgr.D01324.2.639.727Eucgr.D01324.1.644.732Eucgr.D01324.1.644.732
Eucgr.D01324.1.644.732
Fragaria vescamrna19625.1-v1.0-hybrid.209.292mrna19625.1-v1.0-hybrid.209.292mrna19625.1-v1.0-hybrid.209.292mrna19625.1-v1.0-hybrid.384.473mrna19625.1-v1.0-hybrid.384.473
mrna19625.1-v1.0-hybrid.384.473mrna19625.1-v1.0-hybrid.546.633mrna19625.1-v1.0-hybrid.546.633mrna19625.1-v1.0-hybrid.546.633
Glycine maxGlyma13g27480.1.265.348Glyma13g27480.1.265.348Glyma13g27480.1.265.348Glyma15g11500.1.282.365Glyma15g11500.1.282.365
Glyma15g11500.1.282.365Glyma07g39040.2.196.281Glyma07g39040.2.196.281Glyma07g39040.2.196.281Glyma15g11500.1.459.546
Glyma15g11500.1.459.546Glyma15g11500.1.459.546Glyma13g27480.1.442.529Glyma13g27480.1.442.529Glyma13g27480.1.442.529
Glyma07g39040.2.374.462Glyma07g39040.2.374.462Glyma07g39040.2.374.462Glyma15g11500.1.618.706Glyma15g11500.1.618.706
Glyma15g11500.1.618.706Glyma07g39040.2.534.622Glyma07g39040.2.534.622Glyma07g39040.2.534.622Glyma13g27480.1.601.689
Glyma13g27480.1.601.689Glyma13g27480.1.601.689
Gossypium raimondiiGorai.011G013800.6.270.352Gorai.011G013800.6.270.352Gorai.011G013800.6.270.352Gorai.011G013800.5.192.274Gorai.011G013800.5.192.274
Gorai.011G013800.5.192.274Gorai.011G013800.4.192.274Gorai.011G013800.4.192.274Gorai.011G013800.4.192.274Gorai.011G013800.3.192.274
Gorai.011G013800.3.192.274Gorai.011G013800.3.192.274Gorai.011G013800.2.270.352Gorai.011G013800.2.270.352Gorai.011G013800.2.270.352
Gorai.011G013800.1.270.352Gorai.011G013800.1.270.352Gorai.011G013800.1.270.352Gorai.009G178700.6.279.362Gorai.009G178700.6.279.362
Gorai.009G178700.6.279.362Gorai.009G178700.5.279.362Gorai.009G178700.5.279.362Gorai.009G178700.5.279.362Gorai.009G178700.4.157.240
Gorai.009G178700.4.157.240Gorai.009G178700.4.157.240Gorai.009G178700.3.279.362Gorai.009G178700.3.279.362Gorai.009G178700.3.279.362
Gorai.009G178700.2.279.362Gorai.009G178700.2.279.362Gorai.009G178700.2.279.362Gorai.009G178700.1.279.362Gorai.009G178700.1.279.362
Gorai.009G178700.1.279.362Gorai.011G013800.6.444.533Gorai.011G013800.6.444.533Gorai.011G013800.6.444.533Gorai.011G013800.5.366.455
Gorai.011G013800.5.366.455Gorai.011G013800.5.366.455Gorai.011G013800.4.366.455Gorai.011G013800.4.366.455Gorai.011G013800.4.366.455
Gorai.011G013800.3.366.455Gorai.011G013800.3.366.455Gorai.011G013800.3.366.455Gorai.011G013800.2.444.533Gorai.011G013800.2.444.533
Gorai.011G013800.2.444.533Gorai.011G013800.1.444.533Gorai.011G013800.1.444.533Gorai.011G013800.1.444.533Gorai.009G178700.6.454.543
Gorai.009G178700.6.454.543Gorai.009G178700.6.454.543Gorai.009G178700.5.454.543Gorai.009G178700.5.454.543Gorai.009G178700.5.454.543
Gorai.009G178700.4.332.421Gorai.009G178700.4.332.421Gorai.009G178700.4.332.421Gorai.009G178700.3.454.543Gorai.009G178700.3.454.543
Gorai.009G178700.3.454.543Gorai.009G178700.2.454.543Gorai.009G178700.2.454.543Gorai.009G178700.2.454.543Gorai.009G178700.1.454.543
Gorai.009G178700.1.454.543Gorai.009G178700.1.454.543Gorai.009G178700.6.615.703Gorai.009G178700.6.615.703Gorai.009G178700.6.615.703
Gorai.009G178700.5.615.703Gorai.009G178700.5.615.703Gorai.009G178700.5.615.703Gorai.009G178700.4.493.581Gorai.009G178700.4.493.581
Gorai.009G178700.4.493.581Gorai.009G178700.3.615.703Gorai.009G178700.3.615.703Gorai.009G178700.3.615.703Gorai.009G178700.2.615.703
Gorai.009G178700.2.615.703Gorai.009G178700.2.615.703Gorai.009G178700.1.615.703Gorai.009G178700.1.615.703Gorai.009G178700.1.615.703
Gorai.011G013800.6.606.693Gorai.011G013800.6.606.693Gorai.011G013800.6.606.693Gorai.011G013800.5.528.615Gorai.011G013800.5.528.615
Gorai.011G013800.5.528.615Gorai.011G013800.4.528.615Gorai.011G013800.4.528.615Gorai.011G013800.4.528.615Gorai.011G013800.3.528.615
Gorai.011G013800.3.528.615Gorai.011G013800.3.528.615Gorai.011G013800.2.606.693Gorai.011G013800.2.606.693Gorai.011G013800.2.606.693
Gorai.011G013800.1.606.693Gorai.011G013800.1.606.693Gorai.011G013800.1.606.693
Linum usitatissimumLus10020044.225.308Lus10020044.225.308Lus10020044.225.308Lus10006780.228.311Lus10006780.228.311
Lus10006780.228.311Lus10006780.565.653Lus10006780.565.653Lus10006780.565.653Lus10020044.562.650
Lus10020044.562.650Lus10020044.562.650Lus10006780.404.493Lus10006780.404.493Lus10006780.404.493
Lus10020044.401.490Lus10020044.401.490Lus10020044.401.490
Malus domesticaMDP0000191201.257.340MDP0000191201.257.340MDP0000191201.257.340MDP0000151462.257.340MDP0000151462.257.340
MDP0000151462.257.340MDP0000252413.204.287MDP0000252413.204.287MDP0000191201.433.521MDP0000191201.433.521
MDP0000191201.433.521MDP0000151462.433.521MDP0000151462.433.521MDP0000151462.433.521MDP0000585054.156.244
MDP0000585054.156.244MDP0000252413.380.468MDP0000252413.380.468MDP0000191201.594.681MDP0000191201.594.681
MDP0000191201.594.681MDP0000151462.594.681MDP0000151462.594.681MDP0000151462.594.681
Manihot esculentacassava4.1_000528m.264.347cassava4.1_000528m.264.347cassava4.1_000528m.264.347cassava4.1_001042m.91.174cassava4.1_001042m.91.174
cassava4.1_001042m.91.174cassava4.1_000528m.440.528cassava4.1_000528m.440.528cassava4.1_000528m.440.528cassava4.1_001042m.261.348
cassava4.1_001042m.261.348cassava4.1_001042m.261.348cassava4.1_001042m.421.508cassava4.1_001042m.421.508cassava4.1_001042m.421.508
cassava4.1_000528m.601.688cassava4.1_000528m.601.688cassava4.1_000528m.601.688
Mimulus guttatusmgv1a000364m.363.446mgv1a000364m.363.446mgv1a000364m.670.758mgv1a000364m.670.758
Oryza sativaLOC_Os08g09230.2.906.989LOC_Os08g09230.2.906.989LOC_Os08g09230.2.906.989LOC_Os08g09230.1.906.989LOC_Os08g09230.1.906.989
LOC_Os08g09230.1.906.989LOC_Os04g53310.1.334.417LOC_Os04g53310.1.334.417LOC_Os04g53310.1.334.417LOC_Os04g53310.1.508.598
LOC_Os04g53310.1.508.598LOC_Os04g53310.1.508.598LOC_Os04g53310.1.670.758LOC_Os04g53310.1.670.758LOC_Os04g53310.1.670.758
Panicum virgatumPavirv00054440m.151.234Pavirv00054440m.151.234Pavirv00054440m.151.234Pavirv00009477m.238.321Pavirv00009477m.238.321
Pavirv00009477m.238.321Pavirv00019877m.488.571Pavirv00019877m.488.571Pavirv00019877m.488.571Pavirv00009007m.640.723
Pavirv00009007m.640.723Pavirv00009007m.640.723Pavirv00069992m.620.703Pavirv00069992m.620.703Pavirv00069992m.620.703
Pavirv00054440m.325.415Pavirv00054440m.325.415Pavirv00054440m.325.415Pavirv00054440m.487.575Pavirv00054440m.487.575
Pavirv00054440m.487.575Pavirv00069992m.795.882Pavirv00069992m.795.882Pavirv00069992m.795.882Pavirv00009477m.412.502
Pavirv00009477m.412.502Pavirv00009477m.412.502Pavirv00009477m.574.662Pavirv00009477m.574.662Pavirv00009477m.574.662
Pavirv00019877m.663.750Pavirv00019877m.663.750Pavirv00019877m.663.750Pavirv00019877m.824.912Pavirv00019877m.824.912
Pavirv00019877m.824.912Pavirv00009007m.815.902Pavirv00009007m.815.902Pavirv00009007m.815.902
Phaseolus vulgarisPhvul.011G151400.1.281.364Phvul.011G151400.1.281.364Phvul.011G151400.1.281.364Phvul.003G078800.1.198.283Phvul.003G078800.1.198.283
Phvul.003G078800.1.198.283Phvul.011G151400.1.458.545Phvul.011G151400.1.458.545Phvul.011G151400.1.458.545Phvul.003G078800.1.377.463
Phvul.003G078800.1.377.463Phvul.003G078800.1.377.463Phvul.011G151400.1.617.705Phvul.011G151400.1.617.705Phvul.011G151400.1.617.705
Phvul.003G078800.1.536.624Phvul.003G078800.1.536.624Phvul.003G078800.1.536.624
Picea abiesMA_10437241g0010.202.286MA_10437241g0010.202.286MA_10437241g0010.202.286MA_10437241g0010.377.467MA_10437241g0010.377.467
MA_10437241g0010.377.467MA_10437241g0010.540.629MA_10437241g0010.540.629MA_10437241g0010.540.629
Populus trichocarpaPotri.004G014100.2.162.245Potri.004G014100.2.162.245Potri.004G014100.2.162.245Potri.004G014100.1.281.364Potri.004G014100.1.281.364
Potri.004G014100.1.281.364Potri.004G014100.2.337.426Potri.004G014100.2.337.426Potri.004G014100.2.337.426Potri.004G014100.1.456.545
Potri.004G014100.1.456.545Potri.004G014100.1.456.545Potri.004G014100.2.498.586Potri.004G014100.2.498.586Potri.004G014100.2.498.586
Potri.004G014100.1.617.705Potri.004G014100.1.617.705Potri.004G014100.1.617.705
Prunus persicappa001074m.35.118ppa001074m.35.118ppa001074m.35.118ppa001074m.211.299ppa001074m.211.299
ppa001074m.211.299ppa001074m.372.460ppa001074m.372.460ppa001074m.372.460
Ricinus communis29842.m003588.184.26729842.m003588.184.26729842.m003588.184.26729842.m003588.389.47729842.m003588.389.477
29842.m003588.389.47729842.m003588.550.63729842.m003588.550.63729842.m003588.550.637
Setaria italicaSi013121m.535.618Si013121m.535.618Si013121m.535.618Si009214m.272.354Si009214m.272.354
Si009214m.272.354Si015393m.625.708Si015393m.625.708Si015393m.625.708Si009214m.445.535
Si009214m.445.535Si009214m.445.535Si009214m.607.695Si009214m.607.695Si009214m.607.695
Si013121m.706.793Si013121m.706.793Si013121m.706.793Si013121m.868.956Si013121m.868.956
Si013121m.868.956Si015393m.801.887Si015393m.801.887Si015393m.801.887
Selaginella moellendorffii154776.15.97154776.15.97154776.15.97154776.189.279154776.189.279
154776.189.279154776.351.441154776.351.441154776.351.441
Sorghum bicolorSb06g029050.1.309.392Sb06g029050.1.309.392Sb06g029050.1.309.392Sb07g005400.1.782.865Sb07g005400.1.782.865
Sb07g005400.1.782.865Sb06g029050.1.483.573Sb06g029050.1.483.573Sb06g029050.1.483.573Sb06g029050.1.645.733
Sb06g029050.1.645.733Sb06g029050.1.645.733
Thellungiella halophilaThhalv10006781m.209.292Thhalv10006781m.209.292Thhalv10006781m.209.292Thhalv10006631m.209.292Thhalv10006631m.209.292
Thhalv10006631m.209.292Thhalv10006781m.384.477Thhalv10006781m.384.477Thhalv10006781m.384.477Thhalv10006631m.384.477
Thhalv10006631m.384.477Thhalv10006631m.384.477Thhalv10006781m.549.638Thhalv10006781m.549.638Thhalv10006781m.549.638
Thhalv10006631m.549.638Thhalv10006631m.549.638Thhalv10006631m.549.638
Vitis viniferaGSVIVT01012723001.340.428GSVIVT01012723001.340.428GSVIVT01012723001.500.588GSVIVT01012723001.500.588
Volvox carteriVocar20002632m.688.777Vocar20002632m.688.777Vocar20002632m.313.404Vocar20002632m.313.404
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)