y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma13g28910.2
FamilyGH47
Protein PropertiesLength: 611 Molecular Weight: 67833.6 Isoelectric Point: 7.1017
ChromosomeChromosome/Scaffold: 13 Start: 31885107 End: 31889574
Descriptionalpha-mannosidase 3
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH471465530
  AFIHAWSGYKKFAMGYDELMPLSQHGIDGLGGLGATVVDALDTAMIMGLDEVVAEAGSWVEEQLSERISKKGQVNLFETTIRVLGGLLSAYHLSGGEKGT
  NLTHAGPKPAVYLEIAKDLADRLLSAFTASPTAIPFSDVILHDKSAHPAPGGLSSTSEVSTLQLEFNYLSQISGDQKYSLEAMKVMEHMKTLPKIEGLVP
  IYISPHSGEFSGENIRLGSRGDSYYEYLIKVWLQSGASSNTNTSFLYEMYKEAMNGVRHLLVRKSIPNGLVFVGELPYGSNSGFSPKMDHLVCFLPGTLA
  IGATKGLTKKQAMENNMLNFEDLENLKLAEDLTKTCFEMYAVTSTGLAPEIAYFHTEEFSEEGHDGGNKSSEFVNDIIIKPADRHNLLRPETVESLFVLY
  RITEDPKY
Full Sequence
Protein Sequence     Length: 611     Download
MSKSLPYSTK DVHYDNAKFR PRSFFKVVTQ NLLTSNLRRD CGSCSTGKFL FLLLIFGVAY    60
LMLAHASSSG VVSDDQAIVN RKSFYANSSI VNGAGKIKRL WRRPPRLPPR FSPDETGTGN    120
GNGHVLGNPD VVRSMWIARQ KKVKEAFIHA WSGYKKFAMG YDELMPLSQH GIDGLGGLGA    180
TVVDALDTAM IMGLDEVVAE AGSWVEEQLS ERISKKGQVN LFETTIRVLG GLLSAYHLSG    240
GEKGTNLTHA GPKPAVYLEI AKDLADRLLS AFTASPTAIP FSDVILHDKS AHPAPGGLSS    300
TSEVSTLQLE FNYLSQISGD QKYSLEAMKV MEHMKTLPKI EGLVPIYISP HSGEFSGENI    360
RLGSRGDSYY EYLIKVWLQS GASSNTNTSF LYEMYKEAMN GVRHLLVRKS IPNGLVFVGE    420
LPYGSNSGFS PKMDHLVCFL PGTLAIGATK GLTKKQAMEN NMLNFEDLEN LKLAEDLTKT    480
CFEMYAVTST GLAPEIAYFH TEEFSEEGHD GGNKSSEFVN DIIIKPADRH NLLRPETVES    540
LFVLYRITED PKYAFTLLMY KISLYFYFFW PCVRNSENKL NFVFPDSFFF VIIRYEYFVL    600
QISGMGLANL *                                                         660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PTZ00470PTZ004702.0e-130137553420+
pfam01532Glyco_hydro_476.0e-157146553411+
Gene Ontology
GO TermDescription
GO:0004571mannosyl-oligosaccharide 1,2-alpha-mannosidase activity
GO:0005509calcium ion binding
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_001054909.10555311557Os05g0209100 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_564345.1015531543glycoside hydrolase family 47 protein [Arabidopsis thaliana]
RefSeqXP_002275664.1015531555PREDICTED: similar to glycoside hydrolase family 47 protein [Vitis vinifera]
RefSeqXP_002306001.1015531551predicted protein [Populus trichocarpa]
RefSeqXP_002519694.1015531542endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1fmi_A013955310377A Chain A, Crystal Structure Of Human Class I Alpha1,2-Mannosidase
PDB1fo3_A013955310377A Chain A, Crystal Structure Of Human Class I Alpha1,2-Mannosidase
PDB1fo2_A013955310377A Chain A, Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With 1-Deoxymannojirimycin
PDB1x9d_A013955388455A Chain A, Crystal Structure Of Human Class I Alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue
PDB1dl2_A01405536414A Chain A, Crystal Structure Of Class I Alpha-1,2-Mannosidase From Saccharomyces Cerevisiae At 1.54 Angstrom Resolution
Transmembrane Domains
StartEnd
4971
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EX2668753132415530
DT3363453181835000
GO8648062932545460
BG6453612711133830
GO8645303201955080
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_018_00031.1Aquca_018_00031.2Aquca_018_00031.3Aquca_125_00025.1Aquca_125_00025.2
Aquca_125_00025.3Aquca_125_00025.4Aquca_049_00074.1Aquca_002_00310.1Aquca_125_00025.5
Aquca_002_00310.2
Arabidopsis lyrata479633474272890537494638472957
Arabidopsis thalianaAT3G21160.1AT1G51590.1AT1G51590.2AT1G30000.1AT5G43710.1
AT1G27520.1
Brachypodium distachyonBradi5g20920.1Bradi2g32570.1Bradi2g51467.1Bradi3g59640.1
Brassica rapaBra001816Bra014291Bra018917Bra031256Bra010804
Bra032351Bra032833Bra035984
Carica papayaevm.model.supercontig_95.2evm.model.supercontig_166.13evm.model.supercontig_95.1evm.model.supercontig_67.12evm.model.supercontig_110.19
evm.model.supercontig_58.25
Capsella rubellaCarubv10008737mCarubv10013330mCarubv10008589mCarubv10028673mCarubv10008651m
Chlamydomonas reinhardtiiCre07.g336600.t2.1Cre07.g336600.t1.3Cre06.g301600.t1.3.289.614Cre06.g301600.t1.3.289.614Cre06.g301600.t1.3.61.154
Cre06.g301600.t1.3.61.154
Citrus clementinaCiclev10025230mCiclev10014607mCiclev10019471mCiclev10004553m
Citrus sinensisorange1.1g008341morange1.1g008300morange1.1g008122morange1.1g047597m
Cucumis sativusCucsa.359580.9Cucsa.359580.8Cucsa.359580.1Cucsa.047700.1Cucsa.197180.1
Cucsa.254850.1Cucsa.197180.2
Eucalyptus grandisEucgr.F04021.3Eucgr.F04021.2Eucgr.F04021.1Eucgr.C00102.1Eucgr.D00298.2
Eucgr.D00298.1Eucgr.B00341.1Eucgr.H00217.1Eucgr.D00298.3.295.528Eucgr.D00298.3.295.528
Eucgr.D00298.3.92.294Eucgr.D00298.3.92.294
Fragaria vescamrna30596.1-v1.0-hybridmrna05270.1-v1.0-hybrid.98.305mrna05270.1-v1.0-hybrid.98.305mrna17280.1-v1.0-hybrid.95.302mrna17280.1-v1.0-hybrid.95.302
mrna05270.1-v1.0-hybrid.306.507mrna05270.1-v1.0-hybrid.306.507mrna17280.1-v1.0-hybrid.303.483mrna17280.1-v1.0-hybrid.303.483mrna32588.1-v1.0-hybrid
mrna09481.1-v1.0-hybrid.43.302mrna09481.1-v1.0-hybrid.43.302mrna29049.1-v1.0-hybridmrna09481.1-v1.0-hybrid.302.439mrna09481.1-v1.0-hybrid.302.439
Glycine maxGlyma07g02290.1Glyma08g23730.1Glyma17g06600.2Glyma17g06600.1Glyma13g00470.2
Glyma15g10130.1Glyma13g28910.1Glyma05g01830.1Glyma10g32320.1Glyma17g10060.1
Glyma17g10060.3Glyma17g10060.2Glyma05g22295.1Glyma20g35290.1
Gossypium raimondiiGorai.005G122200.2Gorai.005G122200.1Gorai.011G003500.6Gorai.011G003500.2Gorai.011G003500.1
Gorai.011G003500.3Gorai.011G003500.4Gorai.011G003500.5Gorai.010G238600.1Gorai.009G155100.5
Gorai.009G155100.2Gorai.009G155100.1Gorai.009G155100.4Gorai.009G155100.3Gorai.006G187900.2
Gorai.006G187900.1Gorai.006G245800.2Gorai.006G245800.1Gorai.006G187900.3Gorai.006G187900.4
Linum usitatissimumLus10034820Lus10035727Lus10037312Lus10042830Lus10033368.153.381
Lus10033368.153.381Lus10028127Lus10042143Lus10033368.428.563Lus10033368.428.563
Lus10041170Lus10021888.49.301Lus10021888.49.301Lus10004233Lus10021888.303.456
Lus10021888.303.456
Malus domesticaMDP0000857857MDP0000308427MDP0000143766MDP0000156362.354.619MDP0000156362.354.619
MDP0000167309MDP0000316328MDP0000156362.225.356MDP0000156362.225.356MDP0000268730.351.588
MDP0000268730.351.588MDP0000268730.596.800MDP0000268730.596.800MDP0000230215MDP0000208346
MDP0000245188.48.176MDP0000245188.48.176MDP0000319401.48.275MDP0000319401.48.275MDP0000319401.311.449
MDP0000319401.311.449MDP0000245188.210.319MDP0000245188.210.319MDP0000222952
Manihot esculentacassava4.1_026203mcassava4.1_003593mcassava4.1_003599mcassava4.1_011906mcassava4.1_015511m
cassava4.1_003747mcassava4.1_004429m
Medicago truncatulaMedtr4g127310.1Medtr2g019520.2Medtr2g019520.1Medtr2g019520.3Medtr4g106370.1
Medtr1g093270.1
Mimulus guttatusmgv1a003772mmgv1a002872mmgv1a025048mmgv1a002884m
Oryza sativaLOC_Os04g51690.1LOC_Os05g11850.1LOC_Os01g56670.1LOC_Os01g56670.3LOC_Os01g56670.2
LOC_Os02g50780.1LOC_Os01g56670.4
Panicum virgatumPavirv00024177mPavirv00056286mPavirv00057415mPavirv00052269mPavirv00016853m
Pavirv00054954mPavirv00016455mPavirv00000605mPavirv00017739m
Physcomitrella patensPp1s387_34V6.1Pp1s16_48V6.1Pp1s58_280V6.1Pp1s313_34V6.1
Phaseolus vulgarisPhvul.008G254800.1Phvul.003G140700.1Phvul.006G164400.1Phvul.003G197300.1Phvul.007G109800.1
Phvul.006G033000.1Phvul.011G127200.1
Picea abiesMA_10430881g0010MA_10426596g0010MA_311901g0010MA_10180832g0010MA_170877g0010
MA_8281735g0010MA_118584g0010
Populus trichocarpaPotri.018G141100.2Potri.018G141100.1Potri.008G007500.1Potri.008G007500.2Potri.018G141100.3
Potri.018G141100.4Potri.004G132300.1Potri.004G132300.2Potri.004G132300.4Potri.004G132300.3
Potri.015G071400.1Potri.012G076600.1Potri.008G160900.1Potri.015G071400.2Potri.012G076600.2
Prunus persicappa004310mppa026880mppa002795mppa003534mppa002909m
ppa012357m
Ricinus communis28359.m00028030063.m00145129693.m00202130147.m01400429844.m003177
Setaria italicaSi013487mSi009718mSi021445mSi016751mSi004250m
Selaginella moellendorffii1013518511116848592622229806
228194
Sorghum bicolorSb06g027810.1Sb09g006500.1Sb03g036080.1Sb04g028330.1
Thellungiella halophilaThhalv10011358mThhalv10020383mThhalv10007084mThhalv10003168mThhalv10007201m
Vitis viniferaGSVIVT01029601001GSVIVT01029306001GSVIVT01029623001GSVIVT01021446001GSVIVT01007818001
GSVIVT01018097001GSVIVT01029609001
Volvox carteriVocar20012263m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)