y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma13g31020.4
FamilyCBM57
Protein PropertiesLength: 626 Molecular Weight: 68794.4 Isoelectric Point: 8.8013
ChromosomeChromosome/Scaffold: 13 Start: 33490929 End: 33497349
Descriptionreceptor like protein 4
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM572273643.4e-25
  WQHTETFGEDSDRPRSVETRIKQASHPPNFYPETLYRSALVSTSSQPELTYTLDVDPNKNYSVWLHFAEIDNSVTAEGQRVFDIMINGDVAFKDVDIVKL
  SGDRYTALVLNTTVVVNGRTLTIALSPKDGSFAIINAI
Full Sequence
Protein Sequence     Length: 626     Download
MPNIATFRFL LLWMLFLCFA CTARAAQRGP FAMRISCGAR QNVQTKPTTT LWYKDFGYTG    60
GIPTNAKTSS YIAPPLKTLR YFPLSEGPSN CYNINRVPKG HYSIRIFFGL VAQARATDEP    120
LFDISIQGTQ IYSLKSGWTT QDDQAFTEAQ VFLMDGSVSI CFHGTGHGDP AILSIEILQI    180
DNKAYYFGSQ WSQGIILRTV KRLSCGFGQS KYGVDYGADP RGGDRFWQHT ETFGEDSDRP    240
RSVETRIKQA SHPPNFYPET LYRSALVSTS SQPELTYTLD VDPNKNYSVW LHFAEIDNSV    300
TAEGQRVFDI MINGDVAFKD VDIVKLSGDR YTALVLNTTV VVNGRTLTIA LSPKDGSFAI    360
INAIEIMEVI MAESKTLSDE VMALQKLKKA LGLPPRFGWN GDPCVPQQHP WTGADCRLDK    420
SSSKWVIDGL GLDNQGLKGF LPNDISRLHN LQILNLSGNS IQGPIPSPLG TIASLQVLDL    480
SYNFFNGSIP ESLGQLTSLQ RLNLNGNFLS GRVPATLGGR LLHGASFNFT DNAGLCGIPG    540
LPTCGPHLSA GAKVGIGLGV SFTLLLLITG SVCWWKRRQN ILRVQQITAR AAPYAKARTQ    600
FSRDIQMTRH NNNNNAENGP ILLSR*                                         660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam11721Malectin0.00433175166+
PLN00113PLN001132.0e-1443051990+
pfam11721Malectin1.0e-17202364177+
pfam12819Malectin_like5.0e-6535369353+
PLN03150PLN03150010624623+
Gene Ontology
GO TermDescription
GO:0005515protein binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI30598.102862422624unnamed protein product [Vitis vinifera]
RefSeqNP_174156.102662422626AtRLP4 (Receptor Like Protein 4); protein binding [Arabidopsis thaliana]
RefSeqXP_002279791.10336241600PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002305781.10336241596predicted protein [Populus trichocarpa]
RefSeqXP_002509445.1076242629serine-threonine protein kinase, plant-type, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3rgz_A0.0000000000001437551644755A Chain A, Control Of Phosphorylase B Conformation By A Modified Cofactor: Crystallographic Studies On R-State Glycogen Phosphorylase Reconstituted With Pyridoxal 5'-Diphosphate
PDB3rgz_A0.000000004426517467558A Chain A, Control Of Phosphorylase B Conformation By A Modified Cofactor: Crystallographic Studies On R-State Glycogen Phosphorylase Reconstituted With Pyridoxal 5'-Diphosphate
PDB3rgz_A0.0000003424517393486A Chain A, Control Of Phosphorylase B Conformation By A Modified Cofactor: Crystallographic Studies On R-State Glycogen Phosphorylase Reconstituted With Pyridoxal 5'-Diphosphate
PDB3rgz_A0.000003437518454535A Chain A, Control Of Phosphorylase B Conformation By A Modified Cofactor: Crystallographic Studies On R-State Glycogen Phosphorylase Reconstituted With Pyridoxal 5'-Diphosphate
PDB3rgz_A0.000009437539430531A Chain A, Control Of Phosphorylase B Conformation By A Modified Cofactor: Crystallographic Studies On R-State Glycogen Phosphorylase Reconstituted With Pyridoxal 5'-Diphosphate
Transmembrane Domains
StartEnd
726
556575
Signal Peptide
Cleavage Site
25
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO809175179552330
HO8091751782334100
HO7902812311033330
FG94125922912290
FS32624923112310
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01105.1Aquca_026_00194.1Aquca_036_00074.1
Arabidopsis thalianaAT1G28340.1
Brachypodium distachyonBradi1g26830.1
Brassica rapaBra032897
Carica papayaevm.model.supercontig_27.21
Capsella rubellaCarubv10008578m
Citrus clementinaCiclev10014874mCiclev10014609m
Citrus sinensisorange1.1g013887morange1.1g012913morange1.1g010819morange1.1g009515morange1.1g007860m
orange1.1g007307morange1.1g006793morange1.1g015373morange1.1g009603morange1.1g009236m
orange1.1g006940morange1.1g006035m
Cucumis sativusCucsa.147330.1Cucsa.126850.1
Eucalyptus grandisEucgr.G02346.3Eucgr.E03253.2Eucgr.E03253.1Eucgr.D00605.1
Fragaria vescamrna03872.1-v1.0-hybridmrna29734.1-v1.0-hybrid
Glycine maxGlyma02g11090.2Glyma02g11090.1Glyma01g22406.1Glyma20g32720.1Glyma15g08350.4
Glyma15g08350.3Glyma13g31020.3Glyma13g24550.1Glyma07g31970.1Glyma07g31970.2
Gossypium raimondiiGorai.005G138000.3Gorai.005G138000.2Gorai.005G138000.1Gorai.011G029600.2Gorai.011G029600.1
Gorai.006G087900.8Gorai.006G087900.7Gorai.006G087900.6Gorai.006G087900.5Gorai.006G087900.4
Gorai.006G087900.3Gorai.006G087900.2Gorai.006G087900.1
Linum usitatissimumLus10041488Lus10034275Lus10015417Lus10013994Lus10015320
Malus domesticaMDP0000298053MDP0000124675
Manihot esculentacassava4.1_031190mcassava4.1_008047mcassava4.1_003726mcassava4.1_003546mcassava4.1_034042m
Medicago truncatulaMedtr5g053610.1Medtr2g014290.1
Mimulus guttatusmgv1a002935m
Oryza sativaLOC_Os07g31840.1
Panicum virgatumPavirv00022924mPavirv00022923mPavirv00008373m
Physcomitrella patensPp1s83_48V6.1Pp1s199_124V6.1Pp1s5_311V6.1Pp1s1_97V6.1Pp1s2_327V6.1
Pp1s6_364V6.1
Phaseolus vulgarisPhvul.007G102400.1Phvul.003G027500.1Phvul.006G183300.2Phvul.006G183300.1Phvul.002G230800.1
Phvul.003G239400.1
Picea abiesMA_199958g0010MA_41304g0010
Populus trichocarpaPotri.010G129300.3Potri.010G129300.2Potri.010G129300.1Potri.008G117000.2Potri.008G117000.1
Potri.011G056800.2Potri.011G056800.1Potri.004G047300.4Potri.004G047300.3Potri.004G047300.2
Potri.004G047300.1
Prunus persicappa002857mppa003081m
Ricinus communis29738.m00104930190.m011324
Setaria italicaSi029205m
Selaginella moellendorffii133089
Sorghum bicolorSb02g034070.1
Thellungiella halophilaThhalv10007074m
Vitis viniferaGSVIVT01021096001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)