y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma13g32770.1
FamilyGT1
Protein PropertiesLength: 445 Molecular Weight: 50375.6 Isoelectric Point: 6.9271
ChromosomeChromosome/Scaffold: 13 Start: 34839983 End: 34841392
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT12053919.3e-21
  FGKPVLLSGPFIPEPPNTVFEGKWGSWLERFKLGSVVFCVLGTEWKLPHDQFQGLLLGLELTGLPFLAVLKVPIGFETIEAALPEGFKERVEGRGIVHSG
  WIQQQLILEHPSVGCFITHCGAGSLTEALVNKCQIVLLPQVDADHILNARTMATNKVGVEVEKGEEDGLFTKESVCKAVKIVMDDEN
Full Sequence
Protein Sequence     Length: 445     Download
MDASSLHIAM FPWFAMGHLT PYLHLSNKLA KRGHRISFFI PKRTPHKLEQ FNLFPHLITF    60
FPINVPHVEG LPHGAETTSD VSFSLAPLIM TAMDRTEKDI ELLLIELMPQ IVFFDFTYWL    120
PNLTRRLGIK SFYDLMQPPE GYPVSSVKLH AHEVKFLASK RDWEFGSGVL FYHRLNKGLI    180
FSDAVGFKGC REIEGPYVEY LAEQFGKPVL LSGPFIPEPP NTVFEGKWGS WLERFKLGSV    240
VFCVLGTEWK LPHDQFQGLL LGLELTGLPF LAVLKVPIGF ETIEAALPEG FKERVEGRGI    300
VHSGWIQQQL ILEHPSVGCF ITHCGAGSLT EALVNKCQIV LLPQVDADHI LNARTMATNK    360
VGVEVEKGEE DGLFTKESVC KAVKIVMDDE NELGREIKTN HSKVRKFLLN HKLESTCVDS    420
FCQQLRHLLM ISKFQETQLR LSYF*                                          480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02863PLN028635.0e-267397444+
PLN02670PLN026708.0e-622426469+
PLN00414PLN004142.0e-1174425442+
PLN02208PLN022081.0e-1175430449+
PLN02764PLN027643.0e-1211429450+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABL74480.1034295458glucosyltransferase [Ipomoea batatas]
GenBankACU24192.1014291457unknown [Glycine max]
DDBJBAD95881.1034295458glucosyltransferase [Ipomoea nil]
DDBJBAD95882.1034295458glucosyltransferase [Ipomoea purpurea]
RefSeqXP_002522508.1014291456UDP-glucosyltransferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vg8_A9e-1824063451A Chain A, Exo-B-(1,3)-Glucanase From Candida Albicans
PDB2vch_A9e-1824063451A Chain A, Exo-B-(1,3)-Glucanase From Candida Albicans
PDB2vce_A9e-1824063451A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2c9z_A0.000000000000003173406205427A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2c1z_A0.000000000000003173406205427A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
Metabolic Pathways
Pathway NameReactionECProtein Name
anthocyanidin sophoroside metabolismRXN-8176EC-2.4.1cyanidin 3-O-glucoside 2''-O-glucosyltransferase
anthocyanidin sophoroside metabolismRXN-8177EC-2.4.1pelargonidin 3-O-glucoside 2''-O-glucosyltransferase
anthocyanidin sophoroside metabolismRXN-8178EC-2.4.1delphinidin 3-O-glucoside 2''-O-glucosyltransferase
superpathway of anthocyanin biosynthesis (from cyanidin and cyanidin 3-O-glucoside)RXN-8176EC-2.4.1cyanidin 3-O-glucoside 2''-O-glucosyltransferase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO778286425334290
FS33514825522290
FS31706925022240
FS32688925022240
HO778286249320.00006
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_055_00117.1Aquca_038_00188.1Aquca_055_00115.1Aquca_023_00112.1Aquca_011_00587.1
Aquca_011_00580.1
Arabidopsis lyrata474186918511492036495482918509
475492
Arabidopsis thalianaAT3G29630.1AT5G53990.1AT5G54010.1AT5G54060.1AT1G64910.1
Brassica rapaBra029046Bra022688Bra029045
Carica papayaevm.model.supercontig_8.121
Capsella rubellaCarubv10027945m
Citrus clementinaCiclev10017784mCiclev10008184mCiclev10015186m
Citrus sinensisorange1.1g039043morange1.1g017557morange1.1g012080m
Cucumis sativusCucsa.032470.1Cucsa.148900.1Cucsa.148870.1Cucsa.148880.1Cucsa.180970.1
Eucalyptus grandisEucgr.F03293.1Eucgr.F03295.1Eucgr.K01076.1Eucgr.K01079.1Eucgr.F03297.1
Fragaria vescamrna16456.1-v1.0-hybridmrna27158.1-v1.0-hybridmrna20937.1-v1.0-hybridmrna29784.1-v1.0-hybridmrna13733.1-v1.0-hybrid
mrna16457.1-v1.0-hybrid
Glycine maxGlyma10g33790.1Glyma20g33810.1Glyma12g34045.1Glyma06g43880.1Glyma12g14050.1
Glyma13g36500.1Glyma13g36490.1Glyma06g35110.1Glyma12g34030.1Glyma08g44550.1
Gossypium raimondiiGorai.007G157200.1Gorai.002G066600.1Gorai.002G065400.1Gorai.002G065400.2Gorai.002G065300.1
Gorai.010G242800.1Gorai.002G065500.1Gorai.010G230400.1Gorai.010G230200.1Gorai.009G439200.1
Linum usitatissimumLus10008453Lus10013337Lus10040178
Malus domesticaMDP0000311492MDP0000729320MDP0000319451MDP0000729321
Manihot esculentacassava4.1_028194mcassava4.1_024244mcassava4.1_026854mcassava4.1_021802mcassava4.1_007290m
Medicago truncatulaMedtr4g079270.1Medtr4g079250.1Medtr2g014900.1Medtr2g083390.1Medtr2g083420.1
Mimulus guttatusmgv1a019428mmgv1a006277mmgv1a006102mmgv1a006231mmgv1a021196m
Panicum virgatumPavirv00057507m
Phaseolus vulgarisPhvul.007G135800.1Phvul.011G136400.1Phvul.011G115700.1Phvul.005G093600.1Phvul.011G128700.1
Phvul.011G138500.1Phvul.011G138600.1Phvul.005G093300.1Phvul.005G093500.2Phvul.005G093500.1
Populus trichocarpaPotri.011G061000.1Potri.011G060300.1Potri.006G179700.1Potri.011G097900.1
Prunus persicappa022356mppa024453m
Ricinus communis29900.m00155029705.m000575
Sorghum bicolorSb08g003060.1
Thellungiella halophilaThhalv10013536mThhalv10013535mThhalv10028656mThhalv10013471m
Vitis viniferaGSVIVT01014265001GSVIVT01014272001GSVIVT01014269001GSVIVT01014271001GSVIVT01014270001
GSVIVT01014267001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)