y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma13g32910.1
FamilyGT1
Protein PropertiesLength: 463 Molecular Weight: 50303.9 Isoelectric Point: 6.2645
ChromosomeChromosome/Scaffold: 13 Start: 34928386 End: 34929774
DescriptionUDP-glucosyl transferase 78D2
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT12794456.4e-37
  VGSVAYVSFGTVVTPPPHEIVAVAEALEASGVPFLWSLKEHLKGVLPRGFLERTSESGKVVAWAPQTQVLGHGSVGVFVTHCGCNSVFESMSNGVPMICR
  PFFGDHGLTGRMVEDVWEIGVRVEGGVFTKDGLVKCLRLVLVEEEGKKMKENAIKVKKTVVDAAGPQ
Full Sequence
Protein Sequence     Length: 463     Download
MKNSQEKKHV AVFVFPFGSH PVPLLNLVLK LVHATPNNLK FSFLGTEHSN KPLLSKPHIP    60
DTIKFYSISD GVPEGHVPGG HPVERVNFFL EAGPENLQKG IDMAVAETKE SVTCIIADAF    120
VTPSLLVAQH LNVPCVLVWP PLSCSLSAHF HTDLIRQKYD NNSDKNTPLD FIPGLSKMRV    180
EDLPEDVINS TDSEEETLFS KTLASLGSVL PQAEAVVVNF FEELDPPLLV HDMRSKLKSF    240
LYVGFLTLSV PLPPLPPSDT DATGCLSWLD HKQKQNNGVG SVAYVSFGTV VTPPPHEIVA    300
VAEALEASGV PFLWSLKEHL KGVLPRGFLE RTSESGKVVA WAPQTQVLGH GSVGVFVTHC    360
GCNSVFESMS NGVPMICRPF FGDHGLTGRM VEDVWEIGVR VEGGVFTKDG LVKCLRLVLV    420
EEEGKKMKEN AIKVKKTVVD AAGPQGKAAQ DFNTLLEVVS RS*                      480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02210PLN022101.0e-376456468+
pfam00201UDPGT6.0e-3853433402+
PLN02173PLN021735.0e-38108459370+
PLN02448PLN024485.0e-42112436345+
PLN02555PLN025551.0e-49106461374+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACU17764.1054623447unknown [Glycine max]
GenBankADC96620.1054623447UF3GT [Glycine max]
DDBJBAA36972.1014621455flavonoid 3-O-galactosyl transferase [Vigna mungo]
DDBJBAF49297.1014621446UDP-glucose:anthocyanidin 3-O-glucosyltransferase [Clitoria ternatea]
DDBJBAF49298.1054622446UDP-glucose:flavonoid 3-O-glucosyltransferase [Clitoria ternatea]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2c9z_A014611452A Chain A, X-Ray Crystal Structure Of Conserved Hypothetical Upf0122 Protein Sav1236 From Staphylococcus Aureus Subsp. Aureus Mu50
PDB2c1z_A014611452A Chain A, X-Ray Crystal Structure Of Conserved Hypothetical Upf0122 Protein Sav1236 From Staphylococcus Aureus Subsp. Aureus Mu50
PDB2c1x_A014611452A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification
PDB3hbj_A034609453A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification
PDB3hbf_A034609453A Chain A, Structure Of Ugt78g1 Complexed With Myricetin And Udp
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CO9812542422224630
EH26008126812680
CV53001431313120
CV53017130913080
BM1436461972404360
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_031_00073.1Aquca_031_00072.1
Arabidopsis lyrata488567326139313693488566
Arabidopsis thalianaAT5G17040.1AT1G30530.1AT5G17050.1AT5G17030.1
Brachypodium distachyonBradi1g46850.1
Brassica rapaBra023594
Carica papayaevm.model.supercontig_95.70
Capsella rubellaCarubv10000798m
Citrus clementinaCiclev10008258mCiclev10019770mCiclev10030331m
Citrus sinensisorange1.1g012893morange1.1g013878m
Cucumis sativusCucsa.092240.1Cucsa.089640.1
Eucalyptus grandisEucgr.A02964.3Eucgr.A02964.1Eucgr.E02976.1Eucgr.E02345.1Eucgr.I02607.1
Eucgr.E02973.1Eucgr.E02977.1Eucgr.C00191.1Eucgr.A02964.2Eucgr.E02398.1
Eucgr.C01022.1Eucgr.C00833.1Eucgr.A00303.1Eucgr.A00306.1Eucgr.C01021.1
Eucgr.C01020.1Eucgr.C01017.1Eucgr.D00702.1Eucgr.C00831.1Eucgr.L02741.1
Eucgr.L02520.1Eucgr.C01063.1Eucgr.E02978.1Eucgr.A00304.1
Fragaria vescamrna30947.1-v1.0-hybridmrna12591.1-v1.0-hybridmrna19962.1-v1.0-hybridmrna24693.1-v1.0-hybridmrna11466.1-v1.0-hybrid
mrna11467.1-v1.0-hybridmrna13747.1-v1.0-hybridmrna29614.1-v1.0-hybrid
Glycine maxGlyma07g30200.1Glyma13g01220.1Glyma07g30180.1Glyma08g07130.1Glyma07g30190.1
Glyma17g07341.1Glyma15g06390.1Glyma06g39350.2Glyma0060s00320.2
Gossypium raimondiiGorai.003G051800.1Gorai.004G101100.1Gorai.012G009400.1Gorai.012G009300.1Gorai.012G009500.1
Gorai.010G063400.1Gorai.009G050700.1Gorai.008G018000.1
Linum usitatissimumLus10025854
Malus domesticaMDP0000543445MDP0000638691MDP0000478252MDP0000405936
Manihot esculentacassava4.1_007209mcassava4.1_031308mcassava4.1_033139mcassava4.1_028603m
Medicago truncatulaMedtr4g128690.1Medtr4g128720.1
Mimulus guttatusmgv1a006133mmgv1a006788m
Oryza sativaLOC_Os06g09240.1LOC_Os07g05420.1
Panicum virgatumPavirv00029337mPavirv00050970mPavirv00041516mPavirv00063020m
Phaseolus vulgarisPhvul.006G201100.1Phvul.002G214500.1Phvul.003G148300.1Phvul.002G214300.1Phvul.002G214400.1
Populus trichocarpaPotri.013G118700.1Potri.018G096000.1Potri.006G171100.1Potri.006G171200.1Potri.013G143900.1
Potri.009G133300.1Potri.009G078400.1Potri.019G090400.1
Prunus persicappa015939mppa019430mppa015221mppa017941mppa005162m
Ricinus communis28479.m00004729804.m00155830073.m002239
Setaria italicaSi006338mSi010039m
Selaginella moellendorffii105043445660
Sorghum bicolorSb10g006140.1Sb02g038860.1
Thellungiella halophilaThhalv10013472m
Vitis viniferaGSVIVT01037410001GSVIVT01037413001GSVIVT01029129001GSVIVT01029126001GSVIVT01029122001
GSVIVT01024419001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)